KEGG   Streptomyces anulatus: KZO11_28810
Entry
KZO11_28810       CDS       T09280                                 
Name
(GenBank) response regulator
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
sanl  Streptomyces anulatus
Pathway
sanl02020  Two-component system
sanl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sanl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KZO11_28810
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KZO11_28810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sanl02022]
    KZO11_28810
Two-component system [BR:sanl02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   KZO11_28810
SSDB
Motif
Pfam: Response_reg Trans_reg_C MarR_2
Other DBs
NCBI-ProteinID: QYA97336
LinkDB
Position
6536062..6536757
AA seq 231 aa
MTRVLVVDDEPQIVRALVINLKARQYEVDAAPDGATALQLAAARHPDVVLLDLGLPDMDG
VEVIRGLRGWTRVPILVLSARHTSDEKVEALDAGADDYVTKPFGMDELLARLRASVRRAE
PVGQDGGAEDIALVETAGFTVDLAAKKVHRSGRDVRLTPTEWHLLEVLVRNSGRLVSQKQ
LLQEVWGPSYGTETNYLRVYMAQLRRKLEADPSHPRHFVTEPGMGYRFERG
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaccagggtgcttgtggtcgacgacgagccgcagatcgtccgcgccctcgtgatcaac
ctgaaggcgcgccagtacgaggtcgacgccgcgcccgacggggcgaccgccctccagctc
gccgccgcccgccaccccgacgtcgtcctcctggacctcgggctgcccgacatggacggg
gtcgaggtgatcaggggcctgcgcggctggacccgggtgcccatcctcgtcctctccgcg
cgccacacctccgacgagaaggtggaggccctggacgccggggcggacgactacgtcacc
aagccgttcggcatggacgagctgctggcccggctgcgcgcctcggtacgccgggcggaa
ccggtcggtcaggacggcggggccgaggacatcgccctcgtcgagacggccggcttcacc
gtcgacctggcggcgaagaaggtgcaccggtccggccgcgacgtacgcctcacccccacc
gaatggcatctgctggaggtcctcgtccgcaacagcggccgcctggtcagccagaagcag
ctcctccaggaggtctggggtccttcctacggcaccgagaccaactatctgcgggtctac
atggcccagctgcgccgcaagctggaggcggatccctcgcacccccggcacttcgtcacc
gaaccgggcatgggttaccgcttcgagcgcggctga

DBGET integrated database retrieval system