Streptomyces antimycoticus: QR300_26930 Help Entry QR300_26930       CDS       T09335                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sant  Streptomyces antimycoticus Pathway sant00998   Biosynthesis of various antibiotics sant01100   Metabolic pathways sant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QR300_26930    00074 Mycolic acid biosynthesis     QR300_26930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QR300_26930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WJD99328 LinkDB All DBs Position 6166369..6166623 Genome browser AA seq 84 aa AA seqDB search MADAIAALDMDELRTFVADVLDVDEEDVTDDADFVKTLGVDSLMALEVMVVLEKKYSVKL AEREMKDITTLRKVHDLLASKLEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggccgacgccatcgccgccctggacatggacgaactgcgcaccttcgtcgcggatgtg ctcgatgtggacgaggaggacgtcaccgacgacgccgacttcgtcaagacgctgggcgtg gactccctcatggccctcgaggtcatggtcgtcctggagaagaagtactcggtgaagctg gcggagcgggagatgaaggacatcaccacgctccgcaaggtgcacgacctgctcgcctcg aagctggagaagtga

DBGET integrated database retrieval system