Streptomyces antimycoticus: QR300_29775 Help Entry QR300_29775       CDS       T09335                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sant  Streptomyces antimycoticus Pathway sant00998   Biosynthesis of various antibiotics sant01100   Metabolic pathways sant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QR300_29775    00074 Mycolic acid biosynthesis     QR300_29775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QR300_29775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WJD99843 LinkDB All DBs Position complement(6907674..6907922) Genome browser AA seq 82 aa AA seqDB search MAATQEEILEGLAEIVNEIAGIPTEDVLLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAVDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcctcgaaggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtcctgctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtggtcgtcgctgccgaggagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccgtcgactacatcctcaagcac cagggctga

DBGET integrated database retrieval system