Streptomyces angustmyceticus: K7396_18405 Help Entry K7396_18405       CDS       T07927                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sanu  Streptomyces angustmyceticus Pathway sanu00998   Biosynthesis of various antibiotics sanu01100   Metabolic pathways sanu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sanu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K7396_18405    00074 Mycolic acid biosynthesis     K7396_18405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K7396_18405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding LysX_preATP_grasp Motif Other DBs NCBI-ProteinID:  UAL68249 LinkDB All DBs Position 4146205..4146468 Genome browser AA seq 87 aa AA seqDB search MTVPTVPTREEIVAQLAEILHEVAGVVPAEVTEEKSLVEELDVDSLAMAEVIVVAEERFG IELPEEEMKDMRTVLDIVIRVEKRAAS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaccgtcccgaccgtcccgacccgcgaagagatcgttgctcaactcgccgagatcctg cacgaggtggccggcgtggtaccggccgaggtgaccgaggagaagtccctggtcgaggag ttggacgtggactcgctcgcgatggccgaggtcatcgtcgtcgccgaggagcgcttcggg atcgagctgcccgaagaggagatgaaggacatgcgcacggttttggacatcgtgatccgg gtggagaagcgggcggcgtcctga

DBGET integrated database retrieval system