Sanguibacter sp. HDW7: G7063_14195 Help Entry G7063_14195       CDS       T06485                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism sanw  Sanguibacter sp. HDW7 Brite KEGG Orthology (KO) [BR:sanw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sanw03032]     G7063_14195    03036 Chromosome and associated proteins [BR:sanw03036]     G7063_14195    03400 DNA repair and recombination proteins [BR:sanw03400]     G7063_14195 DNA replication proteins [BR:sanw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G7063_14195 Chromosome and associated proteins [BR:sanw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G7063_14195 DNA repair and recombination proteins [BR:sanw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G7063_14195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Pentapeptide Motif Other DBs NCBI-ProteinID:  QIK84635 UniProt:  A0A6G7Z6P6 LinkDB All DBs Position complement(3157801..3158082) Genome browser AA seq 93 aa AA seqDB search MSLNRSDLVSAIAAKADLTKADADRAVAALQEVLIESLGKGEAVKLTGLLSVERVERAAR TGRNPRTGEEISIPAGYGVKLSAGSLLKKAVQG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtcgctcaaccgttccgacctcgtctcggccatcgccgccaaggctgacctcacgaag gcagacgccgaccgcgccgtcgccgctctccaggaggttctcatcgagtccctcggcaag ggcgaggccgtgaagctcacgggtctcctctccgtcgagcgtgtcgagcgcgccgcgcgc acgggccgcaacccgcgcacgggcgaggagatctcgatccccgccggctacggcgtcaag ctctccgccggctcgctgctcaagaaggccgtccagggctga

DBGET integrated database retrieval system