Streptomyces aureoverticillatus: G3H79_11935 Help Entry G3H79_11935       CDS       T08343                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism saov  Streptomyces aureoverticillatus Brite KEGG Orthology (KO) [BR:saov00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     G3H79_11935 Enzymes [BR:saov01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      G3H79_11935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  QIB43696 LinkDB All DBs Position 3198980..3199222 Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQMDREGITYDEINIEHDPDSAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKLAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgcaggctgaag agccagatggaccgcgagggcatcacgtacgacgagatcaacatcgagcacgacccggac tccgcggccttcgtggagaaggcgaacggcggcaaccagacggttcccaccgttctcttc cccgacggttcgacgctgaccaacccctcgctcgcccaggtgaagcagaagctggccgcc tga

DBGET integrated database retrieval system