Streptomyces aureoverticillatus: G3H79_22995 Help Entry G3H79_22995       CDS       T08343                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism saov  Streptomyces aureoverticillatus Brite KEGG Orthology (KO) [BR:saov00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:saov03032]     G3H79_22995    03036 Chromosome and associated proteins [BR:saov03036]     G3H79_22995    03400 DNA repair and recombination proteins [BR:saov03400]     G3H79_22995 DNA replication proteins [BR:saov03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G3H79_22995 Chromosome and associated proteins [BR:saov03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G3H79_22995 DNA repair and recombination proteins [BR:saov03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G3H79_22995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  QIB45510 LinkDB All DBs Position 5682223..5682504 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGEPINIPAGFSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgagaccgtcggcgagatcgttgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcccgcaacccgcagaccggcgagccgatcaacatcccggccggcttcagcgtcaaggtt tcggctggttccaagctgaaggaagcagctaagggcaagtag

DBGET integrated database retrieval system