Streptomyces aureoverticillatus: G3H79_25975 Help Entry G3H79_25975       CDS       T08343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saov  Streptomyces aureoverticillatus Pathway saov00998   Biosynthesis of various antibiotics saov01100   Metabolic pathways saov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G3H79_25975    00074 Mycolic acid biosynthesis     G3H79_25975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G3H79_25975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIB46001 LinkDB All DBs Position complement(6381650..6381898) Genome browser AA seq 82 aa AA seqDB search MAATEKEIVDGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKDLKTVGDATKYILEHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactgagaaggagatcgtcgacggtctcgccgagatcgtcaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaaggacctgaagaccgtcggcgacgcgacgaagtacatcctcgagcac caggcctga

DBGET integrated database retrieval system