Scedosporium apiospermum: SAPIO_CDS5815 Help Entry SAPIO_CDS5815     CDS       T06367                                  Name (RefSeq) DNA-directed RNA polymerase   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism sapo  Scedosporium apiospermum Pathway sapo03020   RNA polymerase sapo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sapo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SAPIO_CDS5815   09124 Replication and repair    03420 Nucleotide excision repair     SAPIO_CDS5815  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sapo03021]     SAPIO_CDS5815    03400 DNA repair and recombination proteins [BR:sapo03400]     SAPIO_CDS5815 Transcription machinery [BR:sapo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SAPIO_CDS5815   RNA polymerase III system    RNA polymerase III      SAPIO_CDS5815   RNA polymerase I system    RNA polymerase I      SAPIO_CDS5815 DNA repair and recombination proteins [BR:sapo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SAPIO_CDS5815 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Pox_RNA_Pol_19 Motif Other DBs NCBI-GeneID:  27724887 NCBI-ProteinID:  XP_016642382 UniProt:  A0A084G5H1 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MSDFGDDVDGGMDEPMYEEEEGGEYWEEEVADEGEADKTNNIDEQDNVVVTGDVAAAAQG KNGPKSMKERRIPNEERTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAI KELKEKKIPLIVRRYLPDGYYEDWTCEELLQ NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgactttggcgacgatgtcgatgggggaatggacgagcctatgtacgaggaggag gagggcggcgagtactgggaggaagaggtagcagacgagggcgaggccgacaagaccaac aatatcgatgaacaagataatgtcgtcgtcacgggcgatgtggcggcggcggctcaaggc aagaatggacccaagtccatgaaggagcgaaggattcccaatgaggaacgtactacaaca ccatacatgaccaagtatgagagggctaggattctaggcacaagggcgcttcagattagc atgaatgcgcccgtgctagttgatctcgaaggcgagaccgacccgctgcaaattgccatc aaggaactcaaggagaagaagattccgctcatcgtgaggaggtaccttcccgatggatac tacgaagattggacctgcgaggaacttctccagtag

DBGET integrated database retrieval system