Scedosporium apiospermum: SAPIO_CDS7667 Help Entry SAPIO_CDS7667     CDS       T06367                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism sapo  Scedosporium apiospermum Pathway sapo03060   Protein export sapo04141   Protein processing in endoplasmic reticulum sapo04145   Phagosome Brite KEGG Orthology (KO) [BR:sapo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SAPIO_CDS7667    04141 Protein processing in endoplasmic reticulum     SAPIO_CDS7667  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SAPIO_CDS7667  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sapo04131]     SAPIO_CDS7667   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sapo02044]     SAPIO_CDS7667 Membrane trafficking [BR:sapo04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SAPIO_CDS7667 Secretion system [BR:sapo02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SAPIO_CDS7667 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  27726739 NCBI-ProteinID:  XP_016641308 UniProt:  A0A084G2E7 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MSSPRASSPTGAATGSSVRPASPSVPGGPRTVIRRRAAADQKEKIANARPSSTRAAGAGG SSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKITRKFSS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtcttctccccgtgcttcgtctcccaccggcgccgccaccggctccagcgtccgaccc gcctcgccctcggttcccggtggtcctaggaccgttatccgtcgaagggcggctgccgac cagaaggagaagattgcaaatgcgcgccctagcagcactcgtgcggcgggcgctggtggc agcagcagcaccatgctgaggctgtataccgatgagtctcctggcctcaaggttgatccc gtcgtcgtcttggttctgtccttggtcttcatcttcagcgttgtcgctctgcacatcatt gccaagatcacccgcaagttctccagctaa

DBGET integrated database retrieval system