Scedosporium apiospermum: SAPIO_CDS9631 Help Entry SAPIO_CDS9631     CDS       T06367                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism sapo  Scedosporium apiospermum Pathway sapo03020   RNA polymerase sapo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sapo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SAPIO_CDS9631   09124 Replication and repair    03420 Nucleotide excision repair     SAPIO_CDS9631  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sapo03021]     SAPIO_CDS9631    03400 DNA repair and recombination proteins [BR:sapo03400]     SAPIO_CDS9631 Transcription machinery [BR:sapo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      SAPIO_CDS9631 DNA repair and recombination proteins [BR:sapo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SAPIO_CDS9631 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Rio2_N Motif Other DBs NCBI-GeneID:  27728703 NCBI-ProteinID:  XP_016639484 UniProt:  A0A084FX73 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MNAPDRFELFLLGEGEKKCEEVPFTAIPNCSDFVIKKEDHTIGNLVSEQLKKHRNVLMAG YKVSHPNVPELFIRIQTDGTITPKEALLSVLEKLLRDLNHLSQEFTREWELRRMVTEGEQ NQNGI NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgaacgctcccgataggttcgagctgttcctccttggagaaggggagaagaaatgcgag gaggttcccttcactgccattcccaactgttccgactttgtcatcaagaaagaagaccac accattggcaacctagtctcggagcagctcaagaagcaccgaaacgtcctgatggccgga tacaaagtttctcaccctaacgtgcctgagctctttatccggatccaaacagacggcacc ataacccccaaggaagccctcctctccgtcctcgagaagctactcagggatctcaaccat ctcagccaagagttcactcgagagtgggaactccggcgtatggtcaccgagggagaacaa aaccaaaatggcatttga

DBGET integrated database retrieval system