Salinispora arenicola: Sare_1051 Help Entry Sare_1051         CDS       T00613                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism saq  Salinispora arenicola Pathway saq00998   Biosynthesis of various antibiotics saq01100   Metabolic pathways saq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sare_1051    00074 Mycolic acid biosynthesis     Sare_1051   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sare_1051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV96960 UniProt:  A8M4N6 LinkDB All DBs Position complement(1178802..1179050) Genome browser AA seq 82 aa AA seqDB search MSTDLREFVVSALRDMKFDVESATDETPLGDGGLELESLSLAELVMQLDKFGVEFSDEEM EKLTDLNLGEFTEEVNRRAEAK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccactgacctgcgagagttcgtcgtttccgcgctccgtgacatgaagttcgatgtg gaatcggcgaccgacgaaaccccactgggcgacggtggactcgaattggagtcactctct ttggccgaactcgtcatgcagctcgacaaattcggcgtcgaattctcggacgaggagatg gagaagctgaccgacctgaacctcggcgagttcacggaagaggtaaatcgtcgcgccgaa gcgaaatag

DBGET integrated database retrieval system