KEGG   Salinispora arenicola: Sare_2032
Entry
Sare_2032         CDS       T00613                                 
Name
(GenBank) cytochrome P450
  KO
K21257  orsellenic acid P450 oxidase [EC:1.14.-.-]
Organism
saq  Salinispora arenicola
Pathway
saq01059  Biosynthesis of enediyne antibiotics
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Module
saq_M00833  Calicheamicin biosynthesis, calicheamicinone => calicheamicin
saq_M00834  Calicheamicin orsellinate moiety biosynthesis, malonyl-CoA => orsellinate-ACP => 5-iodo-2,3-dimethoxyorsellinate-ACP
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sare_2032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saq01008]
    Sare_2032
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Sare_2032
Polyketide biosynthesis proteins [BR:saq01008]
 Polyketide tailoring proteins
  Oxygenase
   Sare_2032
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ABV97902
UniProt: A8LZN9
LinkDB
Position
complement(2325839..2327044)
AA seq 401 aa
MLADAVTAFDPTAVDVRRDPYPSYHWLLRHDPVHRGAHQVWYVSRFADVRAVLGDERFAR
TGIRRFWTDLVGPGLLSQIVGDIILFQDEPDHGRLRGVVGPAFSPSALRRLEPTIEATVN
DLLRPARALGAMDVVADLAYPLALRAVLELLGLPAGDANTVGRWSRAVGRTLDRGATAED
MRRGHAAIAEFADYVERVLAERREDGADLLALMLAAHRSQLMSRNEIVSTVVTFIFTGHE
TVASQLGNGLLSLLDHPEQMELMRRQPHLLPHAVEECLRFDPAVQSNTRQLAADVELHGR
RLRRDDVVVVLAGAANRDPGRYDRPDELDIRRDPVPSMSFGAGMRYCLGSYLARLQLRTA
LGAMVALPDLRLVCSPNELAYQPRTMFRGLTRLPVAFTPAG
NT seq 1206 nt   +upstreamnt  +downstreamnt
gtgttggccgatgccgtgaccgcgttcgatccgaccgccgtcgacgttcggcgcgacccg
tacccgtcgtaccactggctgctccgccacgatccggtgcaccggggcgcccaccaggtc
tggtacgtctcgcgtttcgccgacgtccgcgcggtactcggcgacgaacggttcgcccgt
accggcatccgccggttctggaccgatctggtcgggcccggcctgctcagccagatcgtc
ggcgacatcatcctgttccaggacgagccagaccacggccggctacgtggtgtggtcggc
ccggccttctccccgtcggcgctgcgccgcctggaaccgacgatcgaggccaccgtcaac
gacctgttgcgcccggcgcgggccctcggcgcgatggatgtggtggccgacctggcgtac
ccgctggcgctgcgcgcggtgctcgagctgctcggcctaccggccggcgacgccaacacg
gtcggccgctggtcgcgtgcggtgggccggacactggaccggggcgccaccgccgaggac
atgcggcggggacacgcggccatcgccgagttcgccgactacgtggaacgggtgctggcc
gagcgccgcgaggacggtgcggacctgctggccctgatgctcgccgcccaccggagccag
ctgatgagccgcaacgagatcgtcagcaccgtggtcaccttcatcttcaccggtcatgag
acggtggccagccagctgggcaacggcctgctcagcctcctggaccacccggagcagatg
gagttgatgcgccgacagccgcacctgctaccacacgcggtcgaggaatgcctgcgcttc
gacccggcggtgcagtcgaacacccgacagttggcggccgacgtcgagctgcacggccgg
cggctgcgccgcgacgacgtcgtggtggtcctcgccggcgcggccaaccgggaccccggg
cggtacgaccggcccgacgagctcgacatccgccgcgaccccgtcccgtcgatgtccttc
ggggcgggcatgcgctactgcctcgggtcgtacctggcccggcttcagctgcgtaccgct
ctcggcgccatggtcgcgctgccggacctgcgcttggtctgcagcccgaacgaactggcc
taccagcctcgcacgatgttccgtggtctcacgaggctgccggtcgcgttcacgccggcc
ggctga

DBGET integrated database retrieval system