Salinispora arenicola: Sare_3622 Help Entry Sare_3622         CDS       T00613                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saq  Salinispora arenicola Pathway saq00998   Biosynthesis of various antibiotics saq01100   Metabolic pathways saq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sare_3622    00074 Mycolic acid biosynthesis     Sare_3622   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sare_3622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABV99420 UniProt:  A8LZ60 LinkDB All DBs Position 4179368..4179607 Genome browser AA seq 79 aa AA seqDB search MTRDEITTGLAEILEEVAGVTPDDVAEGKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPDN EVQNLKTVGDAVSYIEAQS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgacgagatcaccaccggcctcgccgagatcctcgaagaggttgccggggtg accccggacgacgtggccgaggggaagtccttcaccgacgacctggacgtcgactcgctg tcgatggtggaggtcgtggtggccgctgaggagaagttcggcgtcaagatcccggacaac gaggtgcagaacctcaagaccgtcggggacgctgtcagctacatcgaggcgcagtcctga

DBGET integrated database retrieval system