Caldimonas aquatica: OMP39_09055 Help Entry OMP39_09055       CDS       T08587                                  Name (GenBank) phenol hydroxylase subunit   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism saqa  Caldimonas aquatica Pathway saqa00361   Chlorocyclohexane and chlorobenzene degradation saqa00362   Benzoate degradation saqa00623   Toluene degradation saqa01100   Metabolic pathways saqa01120   Microbial metabolism in diverse environments saqa01220   Degradation of aromatic compounds Module saqa_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:saqa00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     OMP39_09055    00361 Chlorocyclohexane and chlorobenzene degradation     OMP39_09055    00623 Toluene degradation     OMP39_09055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  UZD53842 LinkDB All DBs Position 2005608..2005823 Genome browser AA seq 71 aa AA seqDB search MTRTAPPPAAEPAMPACDLTQKFVRVLGRKDDLVEFSFSVGWPELSVELLLPTPAFEAFC AEHRVRYLPDD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacgcgaaccgccccgccccctgccgccgagcctgccatgccggcgtgcgacctgacc cagaagttcgtgcgcgtcctcggccgcaaggacgacctcgtcgagttcagcttctcggtc ggctggccggaactgtcggtcgaactgctgctgccgacgccggccttcgaagccttctgc gcggagcaccgcgtgcgctacctgcccgacgactga

DBGET integrated database retrieval system