Schlegelella aquatica: OMP39_09065 Help Entry OMP39_09065       CDS       T08587                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism saqa  Schlegelella aquatica Pathway saqa00361   Chlorocyclohexane and chlorobenzene degradation saqa00362   Benzoate degradation saqa00623   Toluene degradation saqa01100   Metabolic pathways saqa01120   Microbial metabolism in diverse environments saqa01220   Degradation of aromatic compounds Module saqa_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:saqa00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     OMP39_09065    00361 Chlorocyclohexane and chlorobenzene degradation     OMP39_09065    00623 Toluene degradation     OMP39_09065 Enzymes [BR:saqa01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      OMP39_09065     1.14.13.244  phenol 2-monooxygenase (NADH)      OMP39_09065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  UZD53844 LinkDB All DBs Position 2006892..2007176 Genome browser AA seq 94 aa AA seqDB search MTTAATSKVFIAFQDNEEARPVIEAIQADNPEAVTVHSPGLVKIDAPGRLVIRRATVEEH TGRPFDLQQIHVNLVTLSGHIDEDDDEFTLRWNH NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgacgaccgcagccacctccaaggtgttcatcgcgttccaggacaacgaggaagcccgt ccggtgatcgaggccatccaggccgacaaccccgaggccgtgaccgtccattcgcccggg ctcgtgaagatcgacgccccggggcgcctggtcatccgccgcgccacggtcgaggaacac accggccgcccgttcgacctgcagcagatccacgtgaacctcgtcaccctgtccggccac atcgacgaggacgacgacgagttcacgctgcgctggaaccactga

DBGET integrated database retrieval system