Streptomyces aquilus: EJC51_20100 Help Entry EJC51_20100       CDS       T07011                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism saqu  Streptomyces aquilus Brite KEGG Orthology (KO) [BR:saqu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:saqu03032]     EJC51_20100    03036 Chromosome and associated proteins [BR:saqu03036]     EJC51_20100    03400 DNA repair and recombination proteins [BR:saqu03400]     EJC51_20100 DNA replication proteins [BR:saqu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EJC51_20100 Chromosome and associated proteins [BR:saqu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EJC51_20100 DNA repair and recombination proteins [BR:saqu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EJC51_20100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  AZP18190 UniProt:  A0A3Q9BZ94 LinkDB All DBs Position complement(4368508..4368789) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgttctggccgctttcgccgagaccgttggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatccagatcccggccggctacagcgtgaaggtt tcggcgggctccaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system