Sorex araneus (European shrew): 101536907 Help Entry 101536907         CDS       T07854                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism sara  Sorex araneus (European shrew) Pathway sara03272   Virion - Hepatitis viruses sara04382   Cornified envelope formation sara04514   Cell adhesion molecules sara04530   Tight junction sara04670   Leukocyte transendothelial migration sara05160   Hepatitis C Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     101536907 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     101536907 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101536907 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101536907 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     101536907 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     101536907 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sara03037]     101536907 (CLDN1)    04147 Exosome [BR:sara04147]     101536907 (CLDN1)    04515 Cell adhesion molecules [BR:sara04515]     101536907 (CLDN1) Cilium and associated proteins [BR:sara03037]  Other cilia and associated proteins   Stereociliary proteins    101536907 (CLDN1) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    101536907 (CLDN1)   Exosomal proteins of colorectal cancer cells    101536907 (CLDN1) Cell adhesion molecules [BR:sara04515]  Immunoglobulin superfamily   L1 family    101536907 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC TrbC SUR7 Cytochrom_B_C DUF2207_C TMEM174 HAAS_TM CD20 DUF898 DUF2975 Motif Other DBs NCBI-GeneID:  101536907 NCBI-ProteinID:  XP_004603064 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGAIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGVIAICVATVGMKCMKCLEDDEVQKMRMAV VGGVIFLIAGLALLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCILGGA LLCCSCPRKTTSYPTPRPYPKPTPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctgctgggcttcatcctggccttcctgggctggatcggg gccatcgtgagcacggcgctgccccagtggaagatttactcctacgccggcgacaacatc gtcacggcccaggccatctacgaggggctgtggatgtcctgcgtgtcccagagcaccggg cagatccagtgcaaagtctttgactccttgctgaacctgaatagtactttgcaagctact cgtgccttgatggtgattggcatcctcctgggagtaatagccatatgtgtagccactgtt ggcatgaaatgtatgaaatgcctggaagatgacgaggtgcagaagatgcggatggccgtt gttgggggcgtgatatttcttattgcaggtctggctctgttagttgccacagcatggtat ggaaatagaattgttcaagaattctatgaccctatgacaccagtcaatgccaggtatgaa ttcggtcaggctctcttcacgggttgggctgctgcttctctctgtattttgggaggtgcc ctactttgctgctcctgtcccagaaaaacaacatcttacccaacaccaaggccctatccc aaacctacaccttcgagtgggaaagactatgtgtga

DBGET integrated database retrieval system