Sorex araneus (European shrew): 101537571 Help Entry 101537571         CDS       T07854                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism sara  Sorex araneus (European shrew) Pathway sara04080   Neuroactive ligand-receptor interaction sara04081   Hormone signaling sara04911   Insulin secretion sara04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101537571 (CCK)    04081 Hormone signaling     101537571 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     101537571 (CCK)   09154 Digestive system    04972 Pancreatic secretion     101537571 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101537571 (CCK) Cytokines and neuropeptides [BR:sara04052]  Neuropeptides   GPCR binding    101537571 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A VirB8 Motif Other DBs NCBI-GeneID:  101537571 NCBI-ProteinID:  XP_004614601 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MNSCVCLCVLMAVLAAGVLAQPVPAEDPVDPGALQPEEETAPRREQRAVQRVDGDPRAHL GALLARYVQHVRKAPSGRMPPVIKNLQNLHPSHRISDRDYMGWMDFGRRSAEEYE NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacagctgcgtgtgcctgtgcgtgctgatggccgtcctggcggcgggggtcctggcg cagcccgtgcccgcggaggacccggtggatcccggagcgctgcagccggaggaggagacg gcaccccgcagggagcagagagcggtgcagagggtggatggcgatccccgggcgcacctg ggcgcgctgctggccagatacgtgcagcatgtccggaaagcaccttctggccgaatgccc cccgtcattaagaacctgcagaacctgcaccccagccacaggataagtgaccgggactac atgggctggatggactttggccgccgcagcgccgaggagtatgaataa

DBGET integrated database retrieval system