Sorex araneus (European shrew): 101538312 Help Entry 101538312         CDS       T07854                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism sara  Sorex araneus (European shrew) Pathway sara03008   Ribosome biogenesis in eukaryotes sara03083   Polycomb repressive complex sara04064   NF-kappa B signaling pathway sara04137   Mitophagy - animal sara04310   Wnt signaling pathway sara04520   Adherens junction sara05010   Alzheimer disease sara05020   Prion disease sara05022   Pathways of neurodegeneration - multiple diseases sara05162   Measles sara05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     101538312 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     101538312 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     101538312 (CSNK2B)    04064 NF-kappa B signaling pathway     101538312 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101538312 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     101538312 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101538312 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     101538312 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     101538312 (CSNK2B)    05020 Prion disease     101538312 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     101538312 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:sara03009]     101538312 (CSNK2B)    03036 Chromosome and associated proteins [BR:sara03036]     101538312 (CSNK2B) Ribosome biogenesis [BR:sara03009]  Eukaryotic type   90S particles    Kinase     101538312 (CSNK2B) Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      101538312 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  101538312 NCBI-ProteinID:  XP_004621336 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacattcaggacaaattcaacctcactggactcaat gagcaggtgcctcactatcgacaagctttagacatgatcttggacttggaacctgatgaa gagctggaggacaaccccaaccagagcgacctgatcgagcaggcggctgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgggtgtactgtgagaaccagccaatgctt cctatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccctgagtaccggcccaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaagcagccagcaacttcaagagtccagtcaagacgattcgctga

DBGET integrated database retrieval system