Sorex araneus (European shrew): 101539169 Help Entry 101539169         CDS       T07854                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sara  Sorex araneus (European shrew) Pathway sara04137   Mitophagy - animal sara04140   Autophagy - animal sara04144   Endocytosis sara04145   Phagosome sara04148   Efferocytosis sara05132   Salmonella infection sara05146   Amoebiasis sara05152   Tuberculosis Brite KEGG Orthology (KO) [BR:sara00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101539169 (RAB7A)    04145 Phagosome     101539169 (RAB7A)    04140 Autophagy - animal     101539169 (RAB7A)    04137 Mitophagy - animal     101539169 (RAB7A)    04148 Efferocytosis     101539169 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101539169 (RAB7A)    05152 Tuberculosis     101539169 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     101539169 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101539169 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101539169 (RAB7A)    04031 GTP-binding proteins [BR:sara04031]     101539169 (RAB7A) Membrane trafficking [BR:sara04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101539169 (RAB7A) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101539169 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    101539169 (RAB7A)   Exosomal proteins of colorectal cancer cells    101539169 (RAB7A)   Exosomal proteins of bladder cancer cells    101539169 (RAB7A) GTP-binding proteins [BR:sara04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101539169 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  101539169 NCBI-ProteinID:  XP_004613187 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKSDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctccaggaagaaagtgttgctgaaggtcatcatcctgggagattctggggtcggt aagacatccctcatgaaccagtatgtgaacaagaaattcagcaatcagtacaaagccaca ataggagcagacttcctgaccaaggaggtgatggtggacgacagactagtgacgatgcag atctgggacacggcggggcaggagcggttccagtccctcggggtggccttctacagaggc gcagactgctgcgtgctggtgttcgacgtgaccgcccccaacaccttcaagaccctggac agctggagagacgagttcctcatccaggccagcccccgggaccccgagaacttccccttc gtcgtgttgggaaacaagatcgacctcgaaaacagacaagtggccacgaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggccttccagaccatcgcgcggaacgcgctcaagcaggagacagaggtg gagctctacaacgaattccccgagcccatcaaactggacaagagcgaccgggccaaagcc tcggcggagagctgcagctgctga

DBGET integrated database retrieval system