Sorex araneus (European shrew): 101540672 Help Entry 101540672         CDS       T07854                                  Symbol FGF8 Name (RefSeq) fibroblast growth factor 8   KO K04358   fibroblast growth factor Organism sara  Sorex araneus (European shrew) Pathway sara04010   MAPK signaling pathway sara04014   Ras signaling pathway sara04015   Rap1 signaling pathway sara04020   Calcium signaling pathway sara04151   PI3K-Akt signaling pathway sara04810   Regulation of actin cytoskeleton sara05200   Pathways in cancer sara05207   Chemical carcinogenesis - receptor activation sara05218   Melanoma sara05224   Breast cancer sara05226   Gastric cancer Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101540672 (FGF8)    04014 Ras signaling pathway     101540672 (FGF8)    04015 Rap1 signaling pathway     101540672 (FGF8)    04020 Calcium signaling pathway     101540672 (FGF8)    04151 PI3K-Akt signaling pathway     101540672 (FGF8)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101540672 (FGF8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101540672 (FGF8)    05207 Chemical carcinogenesis - receptor activation     101540672 (FGF8)   09162 Cancer: specific types    05226 Gastric cancer     101540672 (FGF8)    05218 Melanoma     101540672 (FGF8)    05224 Breast cancer     101540672 (FGF8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101540672 (FGF8)    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101540672 (FGF8) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Growth factors (RTK binding)    101540672 (FGF8) Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Growth factors/receptors    101540672 (FGF8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF FRG1 Motif Other DBs NCBI-GeneID:  101540672 NCBI-ProteinID:  XP_004616394 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE NNYTALQNAKYEGWYMAFTRKGRPRRGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLN YPPFTRSLRAGQRTWAPEPR NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcggaggacggcgaccccttcgcgaaactcatcgtggagacggacaccttcgggagc agggtccgagtgcgaggtgctgagacgggcctctacatctgcatgaacaagaaagggaag ctgatcgccaagagcaacggcaaaggcaaggactgcgtgttcacggagatcgtgctggag aacaactacacggccctgcagaacgccaagtacgagggctggtacatggccttcacgcgc aagggccggccacgccggggctccaagacgcggcagcaccagcgcgaggtgcatttcatg aagcgcctgccccgcggccaccacaccacggagcagagcctgcgcttcgagttcctcaac tacccgcccttcacgcgcagcctgcgcgccggccagaggacttgggcccccgagccccga tag

DBGET integrated database retrieval system