Sorex araneus (European shrew): 101541308 Help Entry 101541308         CDS       T07854                                  Symbol PPY Name (RefSeq) pancreatic prohormone   KO K05234   pancreatic polypeptide Organism sara  Sorex araneus (European shrew) Pathway sara04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101541308 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101541308 (PPY) Cytokines and neuropeptides [BR:sara04052]  Neuropeptides   GPCR binding    101541308 (PPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  101541308 NCBI-ProteinID:  XP_004621044 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MAAVPRCLALLLLSACLALVLQPPRAARGAPLEPAYPGENATPEQKAHYAAELRRYLNMV TRPRYGKREQDDSANFWESGSPHAAAPREPTPVDL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgccgtgccccgctgcctcgcgctgctgctcctgtccgcctgcctggccctggtg ctgcagcccccgcgggctgccaggggggccccgctggagcccgcctaccccggcgagaac gccaccccggagcagaaggcccactacgccgccgagctccgcagatacctcaacatggtg accaggccgaggtacgggaaacgagagcaggatgactcggcgaacttctgggagtcgggc tccccccacgccgctgctcccagggagcccacccccgtggacctgtag

DBGET integrated database retrieval system