Sorex araneus (European shrew): 101542292 Help Entry 101542292         CDS       T07854                                  Name (RefSeq) ras-related protein ORAB-1-like   KO K07874   Ras-related protein Rab-1A Organism sara  Sorex araneus (European shrew) Pathway sara04140   Autophagy - animal sara05014   Amyotrophic lateral sclerosis sara05022   Pathways of neurodegeneration - multiple diseases sara05134   Legionellosis Brite KEGG Orthology (KO) [BR:sara00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101542292  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     101542292   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101542292    05022 Pathways of neurodegeneration - multiple diseases     101542292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101542292   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101542292    04031 GTP-binding proteins [BR:sara04031]     101542292 Membrane trafficking [BR:sara04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     101542292  Autophagy   Other autophagy associated proteins     101542292 Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101542292   Exosomal proteins of other body fluids (saliva and urine)    101542292   Exosomal proteins of colorectal cancer cells    101542292 GTP-binding proteins [BR:sara04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     101542292 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA SRPRB FeoB_N PduV-EutP AAA_16 AAA_29 AAA_22 AAA_5 AAA_7 ABC_tran TniB Motif Other DBs NCBI-GeneID:  101542292 NCBI-ProteinID:  XP_004622506 LinkDB All DBs Position Unknown AA seq 179 aa AA seqDB search MALNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTDSYISTIGVDFKIRTIDLDGKTIK LQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQESFNNVKLWLQEIERYACESVKKLL VGNKCDLTAKRAVEYSTAKEYADQLGIPFLETSAKNSTNVEQAFLTMAGEIKSRLGDAV NT seq 538 nt NT seq  +upstreamnt  +downstreamnt atggcgctgaatcctgaatacgactacttgttcaaactgctgttgatcggtgactcgggc gttggaaagtcttgcttgttgctacgctttgctgacgacacgtacacggacagctacatt agtaccatcggagtggactttaagattcgaacgatcgatttggacggaaagacgattaag ctgcaaatctgggacacggctggtcaggaacgcttccgcacgatcacctccagttattat cgcggcgcccatggaatcattgtcgtctacgacataaccgatcaggagtctttcaacaac gttaagctatggcttcaagaaatagaacgctacgcgtgcgaaagtgtcaaaaaactccta gtaggaaacaagtgcgatctgacagccaaacgagcggttgaatacagcacggccaaggaa tacgccgaccagttgggtattccgtttctggaaacgtcggccaagaattccaccaatgtt gaacaggcttttttgacgatggccggcgaaatcaagagccgtcttggcgatgccgtcg

DBGET integrated database retrieval system