Sorex araneus (European shrew): 101545321
Help
Entry
101545321 CDS
T07854
Symbol
MAPK12
Name
(RefSeq) mitogen-activated protein kinase 12
KO
K04441
p38 MAP kinase [EC:
2.7.11.24
]
Organism
sara
Sorex araneus (European shrew)
Pathway
sara01522
Endocrine resistance
sara04010
MAPK signaling pathway
sara04015
Rap1 signaling pathway
sara04068
FoxO signaling pathway
sara04071
Sphingolipid signaling pathway
sara04114
Oocyte meiosis
sara04148
Efferocytosis
sara04218
Cellular senescence
sara04261
Adrenergic signaling in cardiomyocytes
sara04370
VEGF signaling pathway
sara04380
Osteoclast differentiation
sara04550
Signaling pathways regulating pluripotency of stem cells
sara04611
Platelet activation
sara04613
Neutrophil extracellular trap formation
sara04620
Toll-like receptor signaling pathway
sara04621
NOD-like receptor signaling pathway
sara04622
RIG-I-like receptor signaling pathway
sara04625
C-type lectin receptor signaling pathway
sara04657
IL-17 signaling pathway
sara04658
Th1 and Th2 cell differentiation
sara04659
Th17 cell differentiation
sara04660
T cell receptor signaling pathway
sara04664
Fc epsilon RI signaling pathway
sara04668
TNF signaling pathway
sara04670
Leukocyte transendothelial migration
sara04714
Thermogenesis
sara04722
Neurotrophin signaling pathway
sara04723
Retrograde endocannabinoid signaling
sara04728
Dopaminergic synapse
sara04750
Inflammatory mediator regulation of TRP channels
sara04912
GnRH signaling pathway
sara04914
Progesterone-mediated oocyte maturation
sara04917
Prolactin signaling pathway
sara04926
Relaxin signaling pathway
sara04932
Non-alcoholic fatty liver disease
sara04933
AGE-RAGE signaling pathway in diabetic complications
sara04935
Growth hormone synthesis, secretion and action
sara04936
Alcoholic liver disease
sara05014
Amyotrophic lateral sclerosis
sara05020
Prion disease
sara05022
Pathways of neurodegeneration - multiple diseases
sara05132
Salmonella infection
sara05133
Pertussis
sara05135
Yersinia infection
sara05140
Leishmaniasis
sara05142
Chagas disease
sara05145
Toxoplasmosis
sara05152
Tuberculosis
sara05161
Hepatitis B
sara05163
Human cytomegalovirus infection
sara05167
Kaposi sarcoma-associated herpesvirus infection
sara05169
Epstein-Barr virus infection
sara05170
Human immunodeficiency virus 1 infection
sara05171
Coronavirus disease - COVID-19
sara05205
Proteoglycans in cancer
sara05208
Chemical carcinogenesis - reactive oxygen species
sara05235
PD-L1 expression and PD-1 checkpoint pathway in cancer
sara05415
Diabetic cardiomyopathy
sara05417
Lipid and atherosclerosis
sara05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
sara00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101545321 (MAPK12)
04015 Rap1 signaling pathway
101545321 (MAPK12)
04370 VEGF signaling pathway
101545321 (MAPK12)
04668 TNF signaling pathway
101545321 (MAPK12)
04068 FoxO signaling pathway
101545321 (MAPK12)
04071 Sphingolipid signaling pathway
101545321 (MAPK12)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
101545321 (MAPK12)
09143 Cell growth and death
04114 Oocyte meiosis
101545321 (MAPK12)
04218 Cellular senescence
101545321 (MAPK12)
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
101545321 (MAPK12)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
101545321 (MAPK12)
04613 Neutrophil extracellular trap formation
101545321 (MAPK12)
04620 Toll-like receptor signaling pathway
101545321 (MAPK12)
04621 NOD-like receptor signaling pathway
101545321 (MAPK12)
04622 RIG-I-like receptor signaling pathway
101545321 (MAPK12)
04625 C-type lectin receptor signaling pathway
101545321 (MAPK12)
04660 T cell receptor signaling pathway
101545321 (MAPK12)
04658 Th1 and Th2 cell differentiation
101545321 (MAPK12)
04659 Th17 cell differentiation
101545321 (MAPK12)
04657 IL-17 signaling pathway
101545321 (MAPK12)
04664 Fc epsilon RI signaling pathway
101545321 (MAPK12)
04670 Leukocyte transendothelial migration
101545321 (MAPK12)
09152 Endocrine system
04912 GnRH signaling pathway
101545321 (MAPK12)
04914 Progesterone-mediated oocyte maturation
101545321 (MAPK12)
04917 Prolactin signaling pathway
101545321 (MAPK12)
04926 Relaxin signaling pathway
101545321 (MAPK12)
04935 Growth hormone synthesis, secretion and action
101545321 (MAPK12)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101545321 (MAPK12)
09156 Nervous system
04728 Dopaminergic synapse
101545321 (MAPK12)
04723 Retrograde endocannabinoid signaling
101545321 (MAPK12)
04722 Neurotrophin signaling pathway
101545321 (MAPK12)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
101545321 (MAPK12)
09158 Development and regeneration
04380 Osteoclast differentiation
101545321 (MAPK12)
09159 Environmental adaptation
04714 Thermogenesis
101545321 (MAPK12)
09160 Human Diseases
09161 Cancer: overview
05205 Proteoglycans in cancer
101545321 (MAPK12)
05208 Chemical carcinogenesis - reactive oxygen species
101545321 (MAPK12)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
101545321 (MAPK12)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
101545321 (MAPK12)
05161 Hepatitis B
101545321 (MAPK12)
05171 Coronavirus disease - COVID-19
101545321 (MAPK12)
05163 Human cytomegalovirus infection
101545321 (MAPK12)
05167 Kaposi sarcoma-associated herpesvirus infection
101545321 (MAPK12)
05169 Epstein-Barr virus infection
101545321 (MAPK12)
09171 Infectious disease: bacterial
05132 Salmonella infection
101545321 (MAPK12)
05135 Yersinia infection
101545321 (MAPK12)
05133 Pertussis
101545321 (MAPK12)
05152 Tuberculosis
101545321 (MAPK12)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
101545321 (MAPK12)
05140 Leishmaniasis
101545321 (MAPK12)
05142 Chagas disease
101545321 (MAPK12)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
101545321 (MAPK12)
05020 Prion disease
101545321 (MAPK12)
05022 Pathways of neurodegeneration - multiple diseases
101545321 (MAPK12)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101545321 (MAPK12)
05418 Fluid shear stress and atherosclerosis
101545321 (MAPK12)
05415 Diabetic cardiomyopathy
101545321 (MAPK12)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
101545321 (MAPK12)
04932 Non-alcoholic fatty liver disease
101545321 (MAPK12)
04933 AGE-RAGE signaling pathway in diabetic complications
101545321 (MAPK12)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
101545321 (MAPK12)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
sara01001
]
101545321 (MAPK12)
Enzymes [BR:
sara01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
101545321 (MAPK12)
Protein kinases [BR:
sara01001
]
Serine/threonine kinases: CMGC group
MAPK family [OT]
101545321 (MAPK12)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Pkinase
PK_Tyr_Ser-Thr
ABC1
APH
Haspin_kinase
Kinase-like
Motif
Other DBs
NCBI-GeneID:
101545321
NCBI-ProteinID:
XP_012788674
LinkDB
All DBs
Position
Unknown
AA seq
287 aa
AA seq
DB search
MRHDNVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKG
LKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNW
MRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPEEFVQRLQSAEAKN
YMKGLPELEKKDFASILTDASPLAVNLLEKMLVLDAEQRVTAAEALTHPYFESLHDTEDE
PKAQKYDESFDDVDRTLEEWKRVTYKEVLSFKPPRHLGVKSSKETAL
NT seq
864 nt
NT seq
+upstream
nt +downstream
nt
atgcgccacgacaacgtgatcggactgctggacgtcttcacccctgatgagaccctggac
gacttcacggacttctatctggtgatgccattcatgggcacggacctgggcaagcttatg
aagcacgagaagctgagcgaggaccgaatccagtttctcgtttaccagatgctgaagggg
ctgaagtacatccacgccgccggcgtcatccacagggacctgaagcccggcaacctggct
gtgaatgaggactgcgagctgaagatcctggactttggcctggccagacaggcggacagc
gagatgactggctacgtggtgactcggtggtaccgggcgcccgaggtcatcctgaactgg
atgcggtacacgcagacagtcgacatctggtcggtgggctgcatcatggcggagatgatc
acgggaaaaacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacgggcacccctcctgaggagtttgtacagagactgcagagtgcagaggccaagaac
tacatgaaggggctcccagagctggagaagaaggatttcgcctccatcctgacggacgcc
agcccgctggcggtgaacctcctggagaagatgctggtgctggacgccgagcagcgggtg
accgcggctgaggcgctcacgcacccctactttgagtccctgcatgacacggaggacgag
cccaaggcccagaagtatgatgagtcgtttgatgacgtggaccgaaccctggaggagtgg
aagcgtgtcacctacaaagaggtgctcagcttcaagcccccccggcacctgggagtcaag
agttccaaggagacggccttgtga
DBGET
integrated database retrieval system