KEGG   Sorex araneus (European shrew): 101546777
Entry
101546777         CDS       T07854                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
sara  Sorex araneus (European shrew)
Pathway
sara01521  EGFR tyrosine kinase inhibitor resistance
sara01522  Endocrine resistance
sara04010  MAPK signaling pathway
sara04012  ErbB signaling pathway
sara04014  Ras signaling pathway
sara04015  Rap1 signaling pathway
sara04062  Chemokine signaling pathway
sara04068  FoxO signaling pathway
sara04071  Sphingolipid signaling pathway
sara04072  Phospholipase D signaling pathway
sara04137  Mitophagy - animal
sara04140  Autophagy - animal
sara04144  Endocytosis
sara04150  mTOR signaling pathway
sara04151  PI3K-Akt signaling pathway
sara04210  Apoptosis
sara04211  Longevity regulating pathway
sara04213  Longevity regulating pathway - multiple species
sara04218  Cellular senescence
sara04360  Axon guidance
sara04370  VEGF signaling pathway
sara04371  Apelin signaling pathway
sara04510  Focal adhesion
sara04540  Gap junction
sara04550  Signaling pathways regulating pluripotency of stem cells
sara04625  C-type lectin receptor signaling pathway
sara04630  JAK-STAT signaling pathway
sara04650  Natural killer cell mediated cytotoxicity
sara04660  T cell receptor signaling pathway
sara04662  B cell receptor signaling pathway
sara04664  Fc epsilon RI signaling pathway
sara04714  Thermogenesis
sara04720  Long-term potentiation
sara04722  Neurotrophin signaling pathway
sara04725  Cholinergic synapse
sara04726  Serotonergic synapse
sara04730  Long-term depression
sara04810  Regulation of actin cytoskeleton
sara04910  Insulin signaling pathway
sara04912  GnRH signaling pathway
sara04915  Estrogen signaling pathway
sara04916  Melanogenesis
sara04917  Prolactin signaling pathway
sara04919  Thyroid hormone signaling pathway
sara04921  Oxytocin signaling pathway
sara04926  Relaxin signaling pathway
sara04929  GnRH secretion
sara04933  AGE-RAGE signaling pathway in diabetic complications
sara04935  Growth hormone synthesis, secretion and action
sara05010  Alzheimer disease
sara05022  Pathways of neurodegeneration - multiple diseases
sara05034  Alcoholism
sara05132  Salmonella infection
sara05160  Hepatitis C
sara05161  Hepatitis B
sara05163  Human cytomegalovirus infection
sara05165  Human papillomavirus infection
sara05166  Human T-cell leukemia virus 1 infection
sara05167  Kaposi sarcoma-associated herpesvirus infection
sara05170  Human immunodeficiency virus 1 infection
sara05200  Pathways in cancer
sara05203  Viral carcinogenesis
sara05205  Proteoglycans in cancer
sara05206  MicroRNAs in cancer
sara05207  Chemical carcinogenesis - receptor activation
sara05208  Chemical carcinogenesis - reactive oxygen species
sara05210  Colorectal cancer
sara05211  Renal cell carcinoma
sara05213  Endometrial cancer
sara05214  Glioma
sara05215  Prostate cancer
sara05216  Thyroid cancer
sara05218  Melanoma
sara05219  Bladder cancer
sara05220  Chronic myeloid leukemia
sara05221  Acute myeloid leukemia
sara05223  Non-small cell lung cancer
sara05224  Breast cancer
sara05225  Hepatocellular carcinoma
sara05226  Gastric cancer
sara05230  Central carbon metabolism in cancer
sara05231  Choline metabolism in cancer
sara05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sara05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sara00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101546777 (HRAS)
   04012 ErbB signaling pathway
    101546777 (HRAS)
   04014 Ras signaling pathway
    101546777 (HRAS)
   04015 Rap1 signaling pathway
    101546777 (HRAS)
   04370 VEGF signaling pathway
    101546777 (HRAS)
   04371 Apelin signaling pathway
    101546777 (HRAS)
   04630 JAK-STAT signaling pathway
    101546777 (HRAS)
   04068 FoxO signaling pathway
    101546777 (HRAS)
   04072 Phospholipase D signaling pathway
    101546777 (HRAS)
   04071 Sphingolipid signaling pathway
    101546777 (HRAS)
   04151 PI3K-Akt signaling pathway
    101546777 (HRAS)
   04150 mTOR signaling pathway
    101546777 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101546777 (HRAS)
   04140 Autophagy - animal
    101546777 (HRAS)
   04137 Mitophagy - animal
    101546777 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101546777 (HRAS)
   04218 Cellular senescence
    101546777 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101546777 (HRAS)
   04540 Gap junction
    101546777 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101546777 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101546777 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101546777 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    101546777 (HRAS)
   04660 T cell receptor signaling pathway
    101546777 (HRAS)
   04662 B cell receptor signaling pathway
    101546777 (HRAS)
   04664 Fc epsilon RI signaling pathway
    101546777 (HRAS)
   04062 Chemokine signaling pathway
    101546777 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101546777 (HRAS)
   04929 GnRH secretion
    101546777 (HRAS)
   04912 GnRH signaling pathway
    101546777 (HRAS)
   04915 Estrogen signaling pathway
    101546777 (HRAS)
   04917 Prolactin signaling pathway
    101546777 (HRAS)
   04921 Oxytocin signaling pathway
    101546777 (HRAS)
   04926 Relaxin signaling pathway
    101546777 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    101546777 (HRAS)
   04919 Thyroid hormone signaling pathway
    101546777 (HRAS)
   04916 Melanogenesis
    101546777 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101546777 (HRAS)
   04726 Serotonergic synapse
    101546777 (HRAS)
   04720 Long-term potentiation
    101546777 (HRAS)
   04730 Long-term depression
    101546777 (HRAS)
   04722 Neurotrophin signaling pathway
    101546777 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101546777 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101546777 (HRAS)
   04213 Longevity regulating pathway - multiple species
    101546777 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101546777 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101546777 (HRAS)
   05206 MicroRNAs in cancer
    101546777 (HRAS)
   05205 Proteoglycans in cancer
    101546777 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    101546777 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101546777 (HRAS)
   05203 Viral carcinogenesis
    101546777 (HRAS)
   05230 Central carbon metabolism in cancer
    101546777 (HRAS)
   05231 Choline metabolism in cancer
    101546777 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101546777 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101546777 (HRAS)
   05225 Hepatocellular carcinoma
    101546777 (HRAS)
   05226 Gastric cancer
    101546777 (HRAS)
   05214 Glioma
    101546777 (HRAS)
   05216 Thyroid cancer
    101546777 (HRAS)
   05221 Acute myeloid leukemia
    101546777 (HRAS)
   05220 Chronic myeloid leukemia
    101546777 (HRAS)
   05218 Melanoma
    101546777 (HRAS)
   05211 Renal cell carcinoma
    101546777 (HRAS)
   05219 Bladder cancer
    101546777 (HRAS)
   05215 Prostate cancer
    101546777 (HRAS)
   05213 Endometrial cancer
    101546777 (HRAS)
   05224 Breast cancer
    101546777 (HRAS)
   05223 Non-small cell lung cancer
    101546777 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101546777 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    101546777 (HRAS)
   05161 Hepatitis B
    101546777 (HRAS)
   05160 Hepatitis C
    101546777 (HRAS)
   05163 Human cytomegalovirus infection
    101546777 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101546777 (HRAS)
   05165 Human papillomavirus infection
    101546777 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101546777 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101546777 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101546777 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    101546777 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101546777 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101546777 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101546777 (HRAS)
   01522 Endocrine resistance
    101546777 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sara04131]
    101546777 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sara04147]
    101546777 (HRAS)
   04031 GTP-binding proteins [BR:sara04031]
    101546777 (HRAS)
Membrane trafficking [BR:sara04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101546777 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101546777 (HRAS)
Exosome [BR:sara04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101546777 (HRAS)
  Exosomal proteins of colorectal cancer cells
   101546777 (HRAS)
GTP-binding proteins [BR:sara04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101546777 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N
Other DBs
NCBI-GeneID: 101546777
NCBI-ProteinID: XP_004602931
UniProt: B3RFG8
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPTVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRLHKARKLSPPDEGGPG
CTSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgccctgacc
atccagctcatccagaaccacttcgtggacgagtacgaccccacgatcgaggactcgtac
cggaagcaggtggtcatcgacggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgttcgccatcaacaacgccaagtcctttgaggacattcaccagtacagggagcaaatc
aagcgcgtgaaggactcggacgacgtccccacggtgctggtggggaacaagtgtgacctg
gcggcgcgcaccgtggagtcgcggcaggcgcaggacctggcgcgcagctacggcatcccc
tacatcgagacgtcggccaagacgcgccagggcgtggaggacgccttctacacactggtg
cgagagatccgcctgcacaaggctcgcaagctgagcccgccggacgagggcggcccgggc
tgcaccagctgccgctgcctgctctcctag

DBGET integrated database retrieval system