Sorex araneus (European shrew): 101546930 Help Entry 101546930         CDS       T07854                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism sara  Sorex araneus (European shrew) Pathway sara04010   MAPK signaling pathway sara04014   Ras signaling pathway sara04015   Rap1 signaling pathway sara04024   cAMP signaling pathway sara04072   Phospholipase D signaling pathway sara04137   Mitophagy - animal sara04140   Autophagy - animal sara04218   Cellular senescence sara04360   Axon guidance sara04371   Apelin signaling pathway sara04625   C-type lectin receptor signaling pathway sara04810   Regulation of actin cytoskeleton sara05132   Salmonella infection sara05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101546930 (RRAS)    04014 Ras signaling pathway     101546930 (RRAS)    04015 Rap1 signaling pathway     101546930 (RRAS)    04371 Apelin signaling pathway     101546930 (RRAS)    04072 Phospholipase D signaling pathway     101546930 (RRAS)    04024 cAMP signaling pathway     101546930 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101546930 (RRAS)    04137 Mitophagy - animal     101546930 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     101546930 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101546930 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101546930 (RRAS)   09158 Development and regeneration    04360 Axon guidance     101546930 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101546930 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101546930 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sara04031]     101546930 (RRAS) GTP-binding proteins [BR:sara04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101546930 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  101546930 NCBI-ProteinID:  XP_004619899 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGWGRPRGGGPGPWDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVS KLFTQILRVKDRDDFPVVLVGNKADLDAQRQVSRSEATSFSASHHVAYFEASAKLRLNVD QAFEQLVRAIRQFQEQELPPSPPSAPRKKSGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggactgggtgggggcggccccggggcggggggccgggg ccctgggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtccgactacgacccc accatcgaggactcctacacgaagatctgctctgtggatggcatccccgcccggctagac atcctggacacggcgggccaggaggagttcggcgccatgcgggagcagtacatgcgcgcc ggccacggcttcctgttggtgtttgcaattaacgaccggcagagtttcaacgaggtgagc aagctcttcacgcagatcctgcgcgtcaaggaccgcgacgactttcccgtcgtattggtc gggaacaaggccgatctggacgcccagcgtcaggtgtcccgatctgaggccacctccttc agtgcctcccaccatgtggcctacttcgaggcctcggccaaactgcgcctcaacgtggat caggcctttgagcagctggtgcgggctatccgacagttccaggagcaagagcttccaccc agccctcccagcgcccccaggaagaagagtggaggctgcccctgtgtcctcctgtaa

DBGET integrated database retrieval system