Sorex araneus (European shrew): 101547476 Help Entry 101547476         CDS       T07854                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism sara  Sorex araneus (European shrew) Pathway sara04613   Neutrophil extracellular trap formation sara05034   Alcoholism sara05203   Viral carcinogenesis sara05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101547476  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101547476   09163 Immune disease    05322 Systemic lupus erythematosus     101547476   09165 Substance dependence    05034 Alcoholism     101547476  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101547476 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101547476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C CENP-S TAF CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa TFIID_20kDa LonB_AAA-LID UPF0137 Motif Other DBs NCBI-GeneID:  101547476 NCBI-ProteinID:  XP_004622458 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK SFLENVVRDAVTYCEHAKRKTVTAMDVVYALKRQGRTIYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaccggacgtggaaaaggcggcaaaggtctcggaaaaggaggagccaaacgtcaccgc aaagttttgcgtgataacatccaaggtatcacgaagcccgcgatccgtcgtttggcgcga cgtggcggcgttaaacgtatcagcggtttaatatatgaagaaactcgtggcgtactgaag tcgttcctcgaaaatgttgttcgcgatgctgtcacctattgtgaacacgcgaaaaggaag accgtaacggcaatggacgttgtctacgctttgaaacgtcagggtcgtacaatttacggc ttcggcggttaa

DBGET integrated database retrieval system