Sorex araneus (European shrew): 101547515 Help Entry 101547515         CDS       T07854                                  Symbol SWI5 Name (RefSeq) DNA repair protein SWI5 homolog   KO K10991   DNA repair protein Swi5/Sae3 Organism sara  Sorex araneus (European shrew) Brite KEGG Orthology (KO) [BR:sara00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sara03400]     101547515 (SWI5) DNA repair and recombination proteins [BR:sara03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      101547515 (SWI5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Swi5 Motif Other DBs NCBI-GeneID:  101547515 NCBI-ProteinID:  XP_004613534 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MHGDVHTHPRVHTHTHLTRTCQGAFRSPRPSPQAAQAGGGSRGSLCLDVERLRAERDALE REIAGLLSDGICVEELDEHISRLHEYNDLKDVGQMLLGKLAVLRGVTTKELYAEFDLDLN D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcacggagatgtgcacacacacccacgggtgcacacgcacacgcacctcacacgtaca tgtcagggggctttccgatccccgcggccctcgccccaggcggcccaggcgggtggcggc agccggggctccctgtgcctggacgtggagaggctgcgggcggagagggacgcgctggag cgggagatcgccgggctcctgtctgacggcatctgcgtggaggagctggacgagcacatc tcacggctccacgagtacaacgacctcaaggacgtgggccagatgctgctgggtaaatta gctgtgctccgaggggtcaccaccaaagagctgtacgcggagtttgacctggacttgaac gactga

DBGET integrated database retrieval system