Sorex araneus (European shrew): 101547553 Help Entry 101547553         CDS       T07854                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism sara  Sorex araneus (European shrew) Pathway sara04613   Neutrophil extracellular trap formation sara05034   Alcoholism sara05203   Viral carcinogenesis sara05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101547553  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101547553   09163 Immune disease    05322 Systemic lupus erythematosus     101547553   09165 Substance dependence    05034 Alcoholism     101547553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101547553 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101547553 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101547553 NCBI-ProteinID:  XP_004621993 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcggcaagggcgggaagggcctgggcaagggcggcgccaagcgccaccgc aaggtgctccgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgg cgcggcggcgtcaagcgcatctcggggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtcatccgcgacgccgtcacctacaccgagcacgccaagcgcaag accgtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctaa

DBGET integrated database retrieval system