Sorex araneus (European shrew): 101547856 Help Entry 101547856         CDS       T07854                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04061   Viral protein interaction with cytokine and cytokine receptor sara04062   Chemokine signaling pathway sara04620   Toll-like receptor signaling pathway sara05142   Chagas disease sara05163   Human cytomegalovirus infection sara05323   Rheumatoid arthritis sara05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101547856    04061 Viral protein interaction with cytokine and cytokine receptor     101547856  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101547856    04062 Chemokine signaling pathway     101547856  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101547856   09174 Infectious disease: parasitic    05142 Chagas disease     101547856   09163 Immune disease    05323 Rheumatoid arthritis     101547856   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101547856  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101547856    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101547856 Cytokines and neuropeptides [BR:sara04052]  Cytokines   Chemokines    101547856 Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Chemokines    101547856 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 RMI1_N_N Motif Other DBs NCBI-GeneID:  101547856 NCBI-ProteinID:  XP_004608911 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MQAPGAAQIILLCTMVALLCSQVLAAPYGADTPTACCFSYASRPVQRKFIVSYFETSSQC SKPGIIFQTKKGRQICANPSEAWVQDLINALEQSSSQPGVTAMSK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaggcccctggcgctgcccagatcatcctcctctgcaccatggtggccctcctctgc agccaggtcctcgcagcaccctatggcgccgacaccccaacagcctgctgcttctcctac gcctccaggccagtacaacgcaaatttatagtcagctatttcgagaccagcagccagtgc tccaagccgggcatcatcttccagaccaaaaagggccggcagatctgtgccaaccccagt gaggcctgggtccaggacctcatcaacgccctggaacagagtagcagccagcctggagtc actgccatgtccaagtga

DBGET integrated database retrieval system