Sorex araneus (European shrew): 101547887 Help Entry 101547887         CDS       T07854                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism sara  Sorex araneus (European shrew) Pathway sara04613   Neutrophil extracellular trap formation sara05034   Alcoholism sara05202   Transcriptional misregulation in cancer sara05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101547887  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101547887   09163 Immune disease    05322 Systemic lupus erythematosus     101547887   09165 Substance dependence    05034 Alcoholism     101547887  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101547887   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101547887 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101547887 Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101547887 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  101547887 NCBI-ProteinID:  XP_012789790 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MGGSDLLLLRHYQKSTEWLIRKLLVQQLVHEIEQGFKTHLRFQGSALLVLQEACETYLVG LFEDTNLCAIHAKRVTTIPKDIQLACRIRGERA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgggtggctcagatttgttactgctccgccactaccagaagtccaccgagtggctcatc cgcaagctgctggtccagcagctggtgcacgagattgagcagggcttcaagacccacctg cgcttccagggctcggccctcctggtgctgcaggaggcgtgtgagacctacctggtgggg ctcttcgaggacacaaacctctgcgccatccatgccaagcgcgtcaccactattcccaag gacatccagctggcctgccgcatccgcggagagagggcataa

DBGET integrated database retrieval system