Sorex araneus (European shrew): 101548226 Help Entry 101548226         CDS       T07854                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism sara  Sorex araneus (European shrew) Pathway sara04081   Hormone signaling sara04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     101548226 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101548226 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101548226 (GAST) Cytokines and neuropeptides [BR:sara04052]  Neuropeptides   GPCR binding    101548226 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  101548226 NCBI-ProteinID:  XP_004608823 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MQPLCVHTLIAALMLASFSEASWRPRAQPPAAPSGPGANRDVEAQWRETMGPASPHLQGP PHQVADLSKKQAPWQEEEEAYGWMDFGRRSAEDTDPHP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcagcctctctgcgtgcacacgctgatcgcggcgctgatgctggcctccttctccgaa gcttcttggaggccccgcgcccagccgccggccgcaccctcggggccaggggccaacagg gacgtggaggcacagtggcgggagaccatgggcccagcctctccccacctgcaaggcccc ccacaccaggtggcagacctgtccaagaagcaggcaccatggcaggaggaagaggaggcc tatggatggatggacttcggccggcgcagcgccgaggacaccgacccgcatccgtag

DBGET integrated database retrieval system