Sorex araneus (European shrew): 101548397 Help Entry 101548397         CDS       T07854                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism sara  Sorex araneus (European shrew) Pathway sara04015   Rap1 signaling pathway sara04810   Regulation of actin cytoskeleton sara05014   Amyotrophic lateral sclerosis sara05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101548397 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101548397 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101548397 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101548397 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101548397 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sara04812]     101548397 (PFN4)    04147 Exosome [BR:sara04147]     101548397 (PFN4) Membrane trafficking [BR:sara04131]  Others   Actin-binding proteins    Others     101548397 (PFN4) Cytoskeleton proteins [BR:sara04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101548397 (PFN4) Exosome [BR:sara04147]  Exosomal proteins   Proteins found in most exosomes    101548397 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101548397 NCBI-ProteinID:  XP_004609450 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDSLLGTRHVDSAALIRLQDQTLCVSSPGFNVMPCDILKLVNGFARNPLQTR REGLYFKEKDYTCVRADDYSLYAKNVNSGVIVVKTHLYLVVSTYTKGMYPSVCVEATEKL GDYLRRKRS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaatttgctgttagattccctcctaggaaccaggcatgtggacagt gcagctctcatccggctccaggaccaaaccctctgtgtctcatcaccagggtttaatgtg atgccctgtgatatcctaaagctggtgaatggctttgccaggaaccctttgcaaacccga agagagggattgtatttcaaagaaaaggattatacatgtgtccgggcagatgactattct ctttatgctaagaatgtgaattctggcgtgattgttgtgaagactcatctgtatcttgtg gtgtcaacttacaccaagggcatgtaccccagtgtctgtgtggaagccacggagaagttg ggtgactacctaagaagaaaaagaagttaa

DBGET integrated database retrieval system