KEGG   Sorex araneus (European shrew): 101548477
Entry
101548477         CDS       T07854                                 
Symbol
VEGFA
Name
(RefSeq) vascular endothelial growth factor A isoform X3
  KO
K05448  vascular endothelial growth factor A
Organism
sara  Sorex araneus (European shrew)
Pathway
sara01521  EGFR tyrosine kinase inhibitor resistance
sara04010  MAPK signaling pathway
sara04014  Ras signaling pathway
sara04015  Rap1 signaling pathway
sara04020  Calcium signaling pathway
sara04066  HIF-1 signaling pathway
sara04151  PI3K-Akt signaling pathway
sara04370  VEGF signaling pathway
sara04510  Focal adhesion
sara04926  Relaxin signaling pathway
sara04933  AGE-RAGE signaling pathway in diabetic complications
sara05163  Human cytomegalovirus infection
sara05165  Human papillomavirus infection
sara05167  Kaposi sarcoma-associated herpesvirus infection
sara05200  Pathways in cancer
sara05205  Proteoglycans in cancer
sara05206  MicroRNAs in cancer
sara05207  Chemical carcinogenesis - receptor activation
sara05208  Chemical carcinogenesis - reactive oxygen species
sara05211  Renal cell carcinoma
sara05212  Pancreatic cancer
sara05219  Bladder cancer
sara05323  Rheumatoid arthritis
sara05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sara00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101548477 (VEGFA)
   04014 Ras signaling pathway
    101548477 (VEGFA)
   04015 Rap1 signaling pathway
    101548477 (VEGFA)
   04370 VEGF signaling pathway
    101548477 (VEGFA)
   04066 HIF-1 signaling pathway
    101548477 (VEGFA)
   04020 Calcium signaling pathway
    101548477 (VEGFA)
   04151 PI3K-Akt signaling pathway
    101548477 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101548477 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101548477 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101548477 (VEGFA)
   05206 MicroRNAs in cancer
    101548477 (VEGFA)
   05205 Proteoglycans in cancer
    101548477 (VEGFA)
   05207 Chemical carcinogenesis - receptor activation
    101548477 (VEGFA)
   05208 Chemical carcinogenesis - reactive oxygen species
    101548477 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101548477 (VEGFA)
   05211 Renal cell carcinoma
    101548477 (VEGFA)
   05219 Bladder cancer
    101548477 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101548477 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101548477 (VEGFA)
   05165 Human papillomavirus infection
    101548477 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101548477 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101548477 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101548477 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101548477 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:sara04052]
    101548477 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:sara00536]
    101548477 (VEGFA)
Cytokines and neuropeptides [BR:sara04052]
 Cytokines
  Growth factors (RTK binding)
   101548477 (VEGFA)
Glycosaminoglycan binding proteins [BR:sara00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101548477 (VEGFA)
SSDB
Motif
Pfam: PDGF VEGF_C
Other DBs
NCBI-GeneID: 101548477
NCBI-ProteinID: XP_004605881
LinkDB
Position
Unknown
AA seq 146 aa
MTEEGEQKPHEVVKFMEVYQRSYCRPLETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEESNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSE
RRKHLFVQDPQTCKCSCKNTDSRCKM
NT seq 441 nt   +upstreamnt  +downstreamnt
atgacagaggagggagagcagaaaccccacgaagtggtgaagttcatggaggtgtaccag
cgcagctactgccggcccctggagacgctggtggacatcttccaggagtaccccgacgag
atcgagtacatcttcaagccgtcgtgcgtgccgctcatgcgctgtggtggctgctgcaat
gacgagggcttggagtgcgtgcccaccgaggagtccaacatcaccatgcagatcatgagg
atcaaacctcaccaaagccagcacataggagagatgagcttcctccagcacagcaaatgt
gaatgcagaccaaagaaagatcgagcaaggcaagaaaatccctgtgggccttgctcagag
cggagaaagcatttgtttgtacaagatccgcagacgtgtaaatgttcctgcaaaaacaca
gactcgcgttgcaagatgtga

DBGET integrated database retrieval system