Sorex araneus (European shrew): 101548477
Help
Entry
101548477 CDS
T07854
Symbol
VEGFA
Name
(RefSeq) vascular endothelial growth factor A isoform X3
KO
K05448
vascular endothelial growth factor A
Organism
sara
Sorex araneus (European shrew)
Pathway
sara01521
EGFR tyrosine kinase inhibitor resistance
sara04010
MAPK signaling pathway
sara04014
Ras signaling pathway
sara04015
Rap1 signaling pathway
sara04020
Calcium signaling pathway
sara04066
HIF-1 signaling pathway
sara04151
PI3K-Akt signaling pathway
sara04370
VEGF signaling pathway
sara04510
Focal adhesion
sara04926
Relaxin signaling pathway
sara04933
AGE-RAGE signaling pathway in diabetic complications
sara05163
Human cytomegalovirus infection
sara05165
Human papillomavirus infection
sara05167
Kaposi sarcoma-associated herpesvirus infection
sara05200
Pathways in cancer
sara05205
Proteoglycans in cancer
sara05206
MicroRNAs in cancer
sara05207
Chemical carcinogenesis - receptor activation
sara05208
Chemical carcinogenesis - reactive oxygen species
sara05211
Renal cell carcinoma
sara05212
Pancreatic cancer
sara05219
Bladder cancer
sara05323
Rheumatoid arthritis
sara05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
sara00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101548477 (VEGFA)
04014 Ras signaling pathway
101548477 (VEGFA)
04015 Rap1 signaling pathway
101548477 (VEGFA)
04370 VEGF signaling pathway
101548477 (VEGFA)
04066 HIF-1 signaling pathway
101548477 (VEGFA)
04020 Calcium signaling pathway
101548477 (VEGFA)
04151 PI3K-Akt signaling pathway
101548477 (VEGFA)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
101548477 (VEGFA)
09150 Organismal Systems
09152 Endocrine system
04926 Relaxin signaling pathway
101548477 (VEGFA)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101548477 (VEGFA)
05206 MicroRNAs in cancer
101548477 (VEGFA)
05205 Proteoglycans in cancer
101548477 (VEGFA)
05207 Chemical carcinogenesis - receptor activation
101548477 (VEGFA)
05208 Chemical carcinogenesis - reactive oxygen species
101548477 (VEGFA)
09162 Cancer: specific types
05212 Pancreatic cancer
101548477 (VEGFA)
05211 Renal cell carcinoma
101548477 (VEGFA)
05219 Bladder cancer
101548477 (VEGFA)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
101548477 (VEGFA)
05167 Kaposi sarcoma-associated herpesvirus infection
101548477 (VEGFA)
05165 Human papillomavirus infection
101548477 (VEGFA)
09163 Immune disease
05323 Rheumatoid arthritis
101548477 (VEGFA)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
101548477 (VEGFA)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
101548477 (VEGFA)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
101548477 (VEGFA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
sara04052
]
101548477 (VEGFA)
00536 Glycosaminoglycan binding proteins [BR:
sara00536
]
101548477 (VEGFA)
Cytokines and neuropeptides [BR:
sara04052
]
Cytokines
Growth factors (RTK binding)
101548477 (VEGFA)
Glycosaminoglycan binding proteins [BR:
sara00536
]
Heparan sulfate / Heparin
Growth factors/receptors
101548477 (VEGFA)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
PDGF
VEGF_C
Motif
Other DBs
NCBI-GeneID:
101548477
NCBI-ProteinID:
XP_004605881
LinkDB
All DBs
Position
Unknown
AA seq
146 aa
AA seq
DB search
MTEEGEQKPHEVVKFMEVYQRSYCRPLETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEESNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSE
RRKHLFVQDPQTCKCSCKNTDSRCKM
NT seq
441 nt
NT seq
+upstream
nt +downstream
nt
atgacagaggagggagagcagaaaccccacgaagtggtgaagttcatggaggtgtaccag
cgcagctactgccggcccctggagacgctggtggacatcttccaggagtaccccgacgag
atcgagtacatcttcaagccgtcgtgcgtgccgctcatgcgctgtggtggctgctgcaat
gacgagggcttggagtgcgtgcccaccgaggagtccaacatcaccatgcagatcatgagg
atcaaacctcaccaaagccagcacataggagagatgagcttcctccagcacagcaaatgt
gaatgcagaccaaagaaagatcgagcaaggcaagaaaatccctgtgggccttgctcagag
cggagaaagcatttgtttgtacaagatccgcagacgtgtaaatgttcctgcaaaaacaca
gactcgcgttgcaagatgtga
DBGET
integrated database retrieval system