Sorex araneus (European shrew): 101548837 Help Entry 101548837         CDS       T07854                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04061   Viral protein interaction with cytokine and cytokine receptor sara04062   Chemokine signaling pathway sara04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101548837 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     101548837 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     101548837 (CCL28)    04062 Chemokine signaling pathway     101548837 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101548837 (CCL28) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Chemokines    101548837 (CCL28) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101548837 NCBI-ProteinID:  XP_004608575 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MQQPALALMALAACVALHASEAILPIASSCCTEVSHHISKRLLQRVTMCRVQKVDGDCDL AAVILHIKHRRICVSPRNRILKQWMKERAAKKNTKGNICHKKNHHRKWKSKVAQKGRRKA HGHKTPH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcagcagccagcattggcgctcatggccctggcagcctgcgtggcccttcatgcttca gaagccatccttcccattgcttctagctgttgcactgaggtttcacatcatatttccaaa aggcttctgcaaagagtgaccatgtgtcgagttcagaaggtggatggggactgtgacttg gctgctgtcatccttcacatcaaacacagaagaatctgtgtcagcccgcgtaatcgcatt cttaagcagtggatgaaagaacgagcagccaagaaaaatactaaaggcaacatttgccat aagaagaaccaccaccgaaagtggaagagtaaggtagcacagaagggcaggcgtaaagcc cacggccataaaacccctcactag

DBGET integrated database retrieval system