KEGG   Sorex araneus (European shrew): 101549109
Entry
101549109         CDS       T07854                                 
Symbol
SLC35A4
Name
(RefSeq) probable UDP-sugar transporter protein SLC35A4
  KO
K15273  solute carrier family 35 (probable UDP-sugar transporter), member A4
Organism
sara  Sorex araneus (European shrew)
Brite
KEGG Orthology (KO) [BR:sara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sara02000]
    101549109 (SLC35A4)
Transporters [BR:sara02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   101549109 (SLC35A4)
SSDB
Motif
Pfam: Nuc_sug_transp EamA
Other DBs
NCBI-GeneID: 101549109
NCBI-ProteinID: XP_004610056
LinkDB
Position
Unknown
AA seq 324 aa
MSVEDGGLRGLGRPRQARWTLMLLLSTTMYGAHAPLLALCHVEGRVPFRPSSAVLLTELT
KLLLCAFSLLVGWQAWPRGAPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSN
LKIGSTALFYCLCLRRRLSARQGLALLLLMAAGACYAAGGLQDPGSTPAGSPAAAAASPM
LLHITPLGLLLLVLYCLVSGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHASSG
PGPGLLEGFSGWAALVVLSQAVNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAALLRL
QLTAAFFLATLLIGLAVRLYYGSH
NT seq 975 nt   +upstreamnt  +downstreamnt
atgagtgtagaggacgggggtctgcgaggcctgggccgtcccaggcaggcccgctggacg
ctgatgctactcctgtccactaccatgtatggtgcccatgccccactgctggccctgtgc
catgtggaaggccgcgtgcccttccggccctcctcagctgtgctgctgacggagctgacc
aagctgctcctgtgcgccttctccctcctggtgggctggcaggcatggccccggggggct
ccaccctggcgccaggctgccccctttgctctatcagccctgctctacggcgcaaacaac
aacctggtgatctacctgcagcggtacatggaccccagcacctaccaggtgctgagcaat
ctcaagattggaagcacagccttgttctactgtctctgcctccggcgccgcctctctgca
cgccagggcttggccctgctgctgctcatggcagcgggggcctgctatgcggcggggggc
ctccaggaccctggcagcaccccagctgggtcccctgcagcagcagccgcaagccccatg
ctcctgcacatcactccactgggactgctgcttctcgtcctgtactgcctcgtctccggc
ctgtcctccgtgtacacagaactgctcatgaagcgccagcggctgcccttggcccttcag
aatctcttcctctacactttcggcgtgcttctaaacctcggcctgcatgcaagcagtggc
ccgggccccggcctcctggagggtttctcgggctgggcagcactcgtggtgctgagccag
gccgtcaacggactgctcatgtcagccgtcatgaagcacggcagtagcatcacacgcctc
ttcgttgtgtcctgctcgctggtggtcaacgctgtgctctcagcagccctgctgcggctg
cagctcacggcggccttcttcctggccacgctgctcattggcctggccgtgcgcctgtac
tatggcagccactag

DBGET integrated database retrieval system