Sorex araneus (European shrew): 101549138 Help Entry 101549138         CDS       T07854                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism sara  Sorex araneus (European shrew) Pathway sara03030   DNA replication sara03410   Base excision repair sara03420   Nucleotide excision repair sara03430   Mismatch repair sara03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101549138 (POLD4)    03410 Base excision repair     101549138 (POLD4)    03420 Nucleotide excision repair     101549138 (POLD4)    03430 Mismatch repair     101549138 (POLD4)    03440 Homologous recombination     101549138 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sara03032]     101549138 (POLD4)    03400 DNA repair and recombination proteins [BR:sara03400]     101549138 (POLD4) DNA replication proteins [BR:sara03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101549138 (POLD4) DNA repair and recombination proteins [BR:sara03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101549138 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      101549138 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  101549138 NCBI-ProteinID:  XP_004618525 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MGRKRLITDSYPIVKRREDPTGPTKGELAPEPGEEPQPEALPLSVDDADLELLRQFDLAW QFGPCTGITRLQRWLRAEQMGLEPPREVLQVLQTHPGDPRYQCSLWHLYPL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcaccgactcctaccccatagtgaagaggagggaggaccct actgggcccaccaagggggagctggcccccgagccaggggaagagccccagcccgaggcc ctgcccctgagtgtggacgacgccgacctggagctgctgaggcagttcgacctggcctgg cagttcggcccctgcacaggcatcacccggctgcagcgctggctccgagcagagcagatg ggcttggagcctccccgagaggtgctccaggtgttgcagacccaccccggagacccccgg taccagtgcagcctctggcatctctatcccctttga

DBGET integrated database retrieval system