Sorex araneus (European shrew): 101551350 Help Entry 101551350         CDS       T07854                                  Symbol ARHGDIA Name (RefSeq) rho GDP-dissociation inhibitor 1   KO K12462   Rho GDP-dissociation inhibitor Organism sara  Sorex araneus (European shrew) Pathway sara04722   Neurotrophin signaling pathway sara04962   Vasopressin-regulated water reabsorption Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101551350 (ARHGDIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101551350 (ARHGDIA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101551350 (ARHGDIA) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101551350 (ARHGDIA)   Exosomal proteins of other body fluids (saliva and urine)    101551350 (ARHGDIA)   Exosomal proteins of colorectal cancer cells    101551350 (ARHGDIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rho_GDI DUF4249 Motif Other DBs NCBI-GeneID:  101551350 NCBI-ProteinID:  XP_004621162 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MATEWLGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYM VGSYGPRAEDYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKEWKD NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccacagagtggctgggcgacctggagagcttcaagaagcagtccttcgtactgaag gagggcgtggagtaccggatcaagatctccttccgggtgaaccgcgagatcgtgtcgggc atgaagtacatccagcacacgtaccggaagggcgtcaagatcgacaagacggactacatg gtgggcagctacgggccccgcgccgaggactacgagttcctcacgcccgtggaggaggcg cccaagggcatgctggcgcggggcagctacagcatcaagtcccgcttcaccgacgacgac aagacggaccacctgtcctgggagtggaacctcaccatcaagaaggagtggaaggactga

DBGET integrated database retrieval system