Sorex araneus (European shrew): 101551634 Help Entry 101551634         CDS       T07854                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism sara  Sorex araneus (European shrew) Brite KEGG Orthology (KO) [BR:sara00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101551634 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      101551634     MLL-HCF complex      101551634     MLL3/MLL4 complex      101551634 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  101551634 NCBI-ProteinID:  XP_012791390 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search RIVENEKVNAEKSSKQKVDLQALPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYL LKNKAQFEDRN NT seq 216 nt NT seq  +upstreamnt  +downstreamnt aggatagtagagaatgagaaggttaatgcagaaaagtcatccaaacagaaggtggatctg caggcgttgcctacccgtgcctacctggatcagactgttgtacctatcttgttacagggc ctggctgtgctcgccaaggagaggccaccaaatcccattgaatttctagcatcatacctt ttaaaaaacaaggcacagtttgaagatcgaaattga

DBGET integrated database retrieval system