KEGG   Sorex araneus (European shrew): 101552276
Entry
101552276         CDS       T07854                                 
Symbol
NDUFS4
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
  KO
K03937  NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
sara  Sorex araneus (European shrew)
Pathway
sara00190  Oxidative phosphorylation
sara01100  Metabolic pathways
sara04714  Thermogenesis
sara04723  Retrograde endocannabinoid signaling
sara04932  Non-alcoholic fatty liver disease
sara05010  Alzheimer disease
sara05012  Parkinson disease
sara05014  Amyotrophic lateral sclerosis
sara05016  Huntington disease
sara05020  Prion disease
sara05022  Pathways of neurodegeneration - multiple diseases
sara05208  Chemical carcinogenesis - reactive oxygen species
sara05415  Diabetic cardiomyopathy
Module
sara_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:sara00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101552276 (NDUFS4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101552276 (NDUFS4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101552276 (NDUFS4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101552276 (NDUFS4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101552276 (NDUFS4)
   05012 Parkinson disease
    101552276 (NDUFS4)
   05014 Amyotrophic lateral sclerosis
    101552276 (NDUFS4)
   05016 Huntington disease
    101552276 (NDUFS4)
   05020 Prion disease
    101552276 (NDUFS4)
   05022 Pathways of neurodegeneration - multiple diseases
    101552276 (NDUFS4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101552276 (NDUFS4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101552276 (NDUFS4)
SSDB
Motif
Pfam: NDUS4 CSN8_PSD8_EIF3K HTH_micro
Other DBs
NCBI-GeneID: 101552276
NCBI-ProteinID: XP_004608582
LinkDB
Position
Unknown
AA seq 121 aa
MAAVSMSAAFRQAIWGRRATAHAALSASRVPTRFLSTSTWKMTPDQAREKQLITVDEKLV
RVLADPLSNMVLTFTTKDDAIAFAEKNGWRYDVEERKVPKPKSKSYGANFSWNKRTRVST
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcggcggtctcaatgtcagcggctttcaggcaagcgatatgggggagaagggcaacg
gctcacgctgccctttctgcttcccgggtcccgaccaggtttttgagcacttcaacatgg
aagatgacaccggatcaagctcgagagaagcaactcataacagttgatgaaaaattggta
agagtgttagctgatcccttgtccaatatggttttaaccttcactactaaagatgatgcc
attgcctttgctgagaaaaatggatggcgctatgacgttgaagagaggaaggttccgaaa
cccaagtccaagtcttatggcgcaaacttttcttggaacaaaagaacaagagtctccaca
aagtag

DBGET integrated database retrieval system