Sorex araneus (European shrew): 101552349 Help Entry 101552349         CDS       T07854                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism sara  Sorex araneus (European shrew) Pathway sara04015   Rap1 signaling pathway sara04810   Regulation of actin cytoskeleton sara05014   Amyotrophic lateral sclerosis sara05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101552349 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101552349 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101552349 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101552349 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101552349 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sara04812]     101552349 (PFN1)    04147 Exosome [BR:sara04147]     101552349 (PFN1) Membrane trafficking [BR:sara04131]  Others   Actin-binding proteins    Others     101552349 (PFN1) Cytoskeleton proteins [BR:sara04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101552349 (PFN1) Exosome [BR:sara04147]  Exosomal proteins   Proteins found in most exosomes    101552349 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101552349 NCBI-ProteinID:  XP_004604989 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRAQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctatatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctctgtgtgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gacggggaatttaccatggatcttcgtaccaagagcactggcggagcccccaccttcaac attactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcgacgtgcccagtac tga

DBGET integrated database retrieval system