Sorex araneus (European shrew): 101553476 Help Entry 101553476         CDS       T07854                                  Symbol STRA13 Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism sara  Sorex araneus (European shrew) Pathway sara03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     101553476 (STRA13)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sara03400]     101553476 (STRA13) DNA repair and recombination proteins [BR:sara03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      101553476 (STRA13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  101553476 NCBI-ProteinID:  XP_004621170 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MEAAGAGFRKELVNKLLLFHFKDDKTKVGGDALQLLAELLKIFVLEAAIRSVRQAQAEDL VRVDVEQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggcggcgggcgcggggttccggaaggagctggtgaacaagctgctgctcttccac ttcaaggacgacaagaccaaagtgggcggggacgcgctgcagctcctggccgagcttctt aagatcttcgtgctagaagcggctatccgcagcgtgcgccaggcccaggcagaggacctg gtccgcgtggacgtggagcagctggagaaagtgctgcctcagctgctcctggacttctag

DBGET integrated database retrieval system