Sorex araneus (European shrew): 101553903 Help Entry 101553903         CDS       T07854                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism sara  Sorex araneus (European shrew) Pathway sara04144   Endocytosis sara04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     101553903 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101553903 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101553903 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101553903 (RAB10)    04031 GTP-binding proteins [BR:sara04031]     101553903 (RAB10) Membrane trafficking [BR:sara04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     101553903 (RAB10)  Protein recycling   Rab GTPases and associated proteins     101553903 (RAB10) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101553903 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    101553903 (RAB10)   Exosomal proteins of colorectal cancer cells    101553903 (RAB10)   Exosomal proteins of bladder cancer cells    101553903 (RAB10) GTP-binding proteins [BR:sara04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     101553903 (RAB10) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DUF3963 Motif Other DBs NCBI-GeneID:  101553903 NCBI-ProteinID:  XP_012790526 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MEEEGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFE NISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANIN IEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagggaatagactttaagatcaaaacagttgaattacaaggaaagaagata aagctacagatatgggatacagcggggcaggagcgatttcacaccatcacaacctcctac tacagaggagcaatgggtatcatgctagtatatgacatcaccaatgggaaaagtttcgaa aacatcagcaagtggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatg ttactaggaaacaagtgtgatatggacgataaaagagttgtacctaaaggaaaaggagaa cagattgcaagggagcatggtattagattttttgagactagtgcaaaagcaaatataaac atcgaaaaggcgttcctcacattagccgaagatatactccgaaagacccccgtaaaagag cccaacagtgagaatgtagatatcagcagtggaggcggagtgacgggctggaagagcaaa tgttgctga

DBGET integrated database retrieval system