Sorex araneus (European shrew): 101554147 Help Entry 101554147         CDS       T07854                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism sara  Sorex araneus (European shrew) Pathway sara04010   MAPK signaling pathway sara04014   Ras signaling pathway sara04024   cAMP signaling pathway sara04072   Phospholipase D signaling pathway sara04137   Mitophagy - animal sara04140   Autophagy - animal sara04218   Cellular senescence sara04371   Apelin signaling pathway sara04625   C-type lectin receptor signaling pathway sara04810   Regulation of actin cytoskeleton sara05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101554147 (RRAS2)    04014 Ras signaling pathway     101554147 (RRAS2)    04371 Apelin signaling pathway     101554147 (RRAS2)    04072 Phospholipase D signaling pathway     101554147 (RRAS2)    04024 cAMP signaling pathway     101554147 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101554147 (RRAS2)    04137 Mitophagy - animal     101554147 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     101554147 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101554147 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101554147 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101554147 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101554147 (RRAS2)    04031 GTP-binding proteins [BR:sara04031]     101554147 (RRAS2) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101554147 (RRAS2)   Exosomal proteins of bladder cancer cells    101554147 (RRAS2) GTP-binding proteins [BR:sara04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101554147 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 CTD10 NPHI_C Motif Other DBs NCBI-GeneID:  101554147 NCBI-ProteinID:  XP_004613713 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MRFFFLQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGF LLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQL KVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgagatttttttttttacagtcctattttgtgacagattatgatccaaccattgaagat tcttacacaaagcagtgtgtcatagatgatagagctgcccgtctagatatcctagatact gcaggacaagaagagtttggagctatgagagaacagtatatgagaactggcgaggggttc ttgttggtcttttcagtcacagatagaggcagttttgaagaaatttataaatttcaaaga cagattctcagagtaaaggatcgtgatgagtttccaatgattttaattggtaataaagct gatctggatcatcaaagacaggtaacacaggaagaaggacagcaattagcacggcagctt aaagtaacatatatggaggcatcagcaaagatcaggatgaatgtagatcaagccttccat gaacttgtccgggttatacggaagtttcaagagcaggaatgtcctccttcaccagaacca actaggaaagaaaaagacaagaaaggctgccattgtgtcattttctaa

DBGET integrated database retrieval system