Sorex araneus (European shrew): 101554730 Help Entry 101554730         CDS       T07854                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism sara  Sorex araneus (European shrew) Pathway sara04613   Neutrophil extracellular trap formation sara05034   Alcoholism sara05203   Viral carcinogenesis sara05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101554730  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101554730   09163 Immune disease    05322 Systemic lupus erythematosus     101554730   09165 Substance dependence    05034 Alcoholism     101554730  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101554730   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101554730 Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101554730 Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101554730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF Motif Other DBs NCBI-GeneID:  101554730 NCBI-ProteinID:  XP_004606678 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MDRPVPEIVSEETTLEEAEEPAEAEQKAAKPKTQKRRRRVRQPRCSPNGMSCRRTYESFA LYFPRVLKNVQEGMSLSQQAICVLDSFVEDIFERIAREAAQLTRASNRVTITCDEVQRAV RMLLPRDLAKHAELEGTRAVLRYTNNR NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggatcggccagttccagagatcgtgtcggaggagaccaccctcgaggaagcagaagaa cctgcagaggctgagcagaaggctgcgaagcccaagacgcagaagcgccgccgccgcgtc cggcagccccgctgcagcccaaatggtatgtcctgccgtcgtacctacgaaagcttcgcc ctctacttcccgagggtcctgaagaatgtccaggagggcatgagcctctcacagcaggcc atatgtgtcctggactcgtttgtggaagacatcttcgagcgcatcgcccgggaggcggcg cagctgacccgggccagcaaccgtgtgaccattacgtgcgatgaggtccagagggctgtg cggatgctgctgccacgagacctggccaagcatgctgagctggaaggcaccagggccgtc ctccgctacaccaacaacagatga

DBGET integrated database retrieval system