Sorex araneus (European shrew): 101555666 Help Entry 101555666         CDS       T07854                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism sara  Sorex araneus (European shrew) Pathway sara04144   Endocytosis sara04510   Focal adhesion sara05020   Prion disease sara05100   Bacterial invasion of epithelial cells sara05205   Proteoglycans in cancer sara05410   Hypertrophic cardiomyopathy sara05412   Arrhythmogenic right ventricular cardiomyopathy sara05414   Dilated cardiomyopathy sara05416   Viral myocarditis sara05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101555666 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101555666 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101555666 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101555666 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     101555666 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101555666 (CAV3)    05410 Hypertrophic cardiomyopathy     101555666 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     101555666 (CAV3)    05414 Dilated cardiomyopathy     101555666 (CAV3)    05416 Viral myocarditis     101555666 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sara04131]     101555666 (CAV3) Membrane trafficking [BR:sara04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     101555666 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin QcrA_N Motif Other DBs NCBI-GeneID:  101555666 NCBI-ProteinID:  XP_004616054 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMPEEHNDLEARIVRDVHSKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLTTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCVRTFCNPVFAALGQACGSIRVLLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatgcccgaggagcacaatgacctggaggcccgaatcgtgagggacgtgcacagcaag gagatcgacctggtgaacagggaccccaagaacatcaacgaggacatcgtcaaggtggac ttcgaggatgtgatcgcggagccggtgggcacctacagcttcgacggcgtgtggaaggtg agctacaccaccttcaccgtgtccaagtactggtgctaccgcctgctgaccacgctgctg ggcgtgccgctggcgctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccctgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactcgctctgcgtgcgcaccttctgcaaccccgtcttcgccgcgctgggccaggcgtgc ggcagcatccgggtgctgctgcggaaggaggtgtga

DBGET integrated database retrieval system