Sorex araneus (European shrew): 101556429 Help Entry 101556429         CDS       T07854                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04061   Viral protein interaction with cytokine and cytokine receptor sara04151   PI3K-Akt signaling pathway sara04625   C-type lectin receptor signaling pathway sara04630   JAK-STAT signaling pathway sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04672   Intestinal immune network for IgA production sara04940   Type I diabetes mellitus sara05135   Yersinia infection sara05142   Chagas disease sara05162   Measles sara05166   Human T-cell leukemia virus 1 infection sara05171   Coronavirus disease - COVID-19 sara05200   Pathways in cancer sara05320   Autoimmune thyroid disease sara05321   Inflammatory bowel disease sara05330   Allograft rejection sara05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101556429 (IL2)    04151 PI3K-Akt signaling pathway     101556429 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101556429 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     101556429 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101556429 (IL2)    04660 T cell receptor signaling pathway     101556429 (IL2)    04658 Th1 and Th2 cell differentiation     101556429 (IL2)    04659 Th17 cell differentiation     101556429 (IL2)    04672 Intestinal immune network for IgA production     101556429 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101556429 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101556429 (IL2)    05171 Coronavirus disease - COVID-19     101556429 (IL2)    05162 Measles     101556429 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101556429 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     101556429 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     101556429 (IL2)    05321 Inflammatory bowel disease     101556429 (IL2)    05330 Allograft rejection     101556429 (IL2)    05332 Graft-versus-host disease     101556429 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101556429 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101556429 (IL2)    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101556429 (IL2) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Interleukins    101556429 (IL2) Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Cytokines    101556429 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  101556429 NCBI-ProteinID:  XP_004606348 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MHRLQLLACATLTLALLATSAPTSRSTQAAQQQLEHLLLDLQLLQKGVENYKNLRVPRMF KFYLPKKATELKHLQCLAEELTSLEEVLNLAQGKNAVIKDLMSNINVTVLELKGSETSSA CDYEDEPVSLTDFLTRWITSCQGIFSTLA NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcacaggctgcagctcctggcctgtgccacgctcacgctcgcactcctcgccaccagt gcacccacctccaggtcgacccaggcggcacagcagcagctggagcacttgctgctggac ttacagctccttcagaaaggagtggagaattacaagaacctcagagtccccaggatgttt aaattttacttgcccaaaaaggccactgaactgaagcatcttcagtgtctagcagaagaa ctcacatctttggaggaagtactaaatctagctcaaggcaagaatgcagttatcaaggac ttaatgagcaacatcaatgtgacagtcctggaactaaagggttcagaaacaagctccgcc tgtgattatgaggatgagccagtgagcctcacagactttctcaccagatggatcacctct tgtcaaggcatcttctcaacactcgcttga

DBGET integrated database retrieval system