Sorex araneus (European shrew): 101556800 Help Entry 101556800         CDS       T07854                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism sara  Sorex araneus (European shrew) Pathway sara04010   MAPK signaling pathway sara04020   Calcium signaling pathway sara04022   cGMP-PKG signaling pathway sara04114   Oocyte meiosis sara04218   Cellular senescence sara04310   Wnt signaling pathway sara04360   Axon guidance sara04370   VEGF signaling pathway sara04380   Osteoclast differentiation sara04625   C-type lectin receptor signaling pathway sara04650   Natural killer cell mediated cytotoxicity sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04662   B cell receptor signaling pathway sara04720   Long-term potentiation sara04724   Glutamatergic synapse sara04921   Oxytocin signaling pathway sara04922   Glucagon signaling pathway sara04924   Renin secretion sara05010   Alzheimer disease sara05014   Amyotrophic lateral sclerosis sara05020   Prion disease sara05022   Pathways of neurodegeneration - multiple diseases sara05031   Amphetamine addiction sara05152   Tuberculosis sara05163   Human cytomegalovirus infection sara05166   Human T-cell leukemia virus 1 infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05170   Human immunodeficiency virus 1 infection sara05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sara05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101556800 (PPP3R1)    04310 Wnt signaling pathway     101556800 (PPP3R1)    04370 VEGF signaling pathway     101556800 (PPP3R1)    04020 Calcium signaling pathway     101556800 (PPP3R1)    04022 cGMP-PKG signaling pathway     101556800 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101556800 (PPP3R1)    04218 Cellular senescence     101556800 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101556800 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     101556800 (PPP3R1)    04660 T cell receptor signaling pathway     101556800 (PPP3R1)    04658 Th1 and Th2 cell differentiation     101556800 (PPP3R1)    04659 Th17 cell differentiation     101556800 (PPP3R1)    04662 B cell receptor signaling pathway     101556800 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     101556800 (PPP3R1)    04921 Oxytocin signaling pathway     101556800 (PPP3R1)    04924 Renin secretion     101556800 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     101556800 (PPP3R1)    04720 Long-term potentiation     101556800 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     101556800 (PPP3R1)    04380 Osteoclast differentiation     101556800 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101556800 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101556800 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     101556800 (PPP3R1)    05163 Human cytomegalovirus infection     101556800 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     101556800 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     101556800 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     101556800 (PPP3R1)    05014 Amyotrophic lateral sclerosis     101556800 (PPP3R1)    05020 Prion disease     101556800 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     101556800 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     101556800 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101556800 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sara01009]     101556800 (PPP3R1) Protein phosphatases and associated proteins [BR:sara01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101556800 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  101556800 NCBI-ProteinID:  XP_004609334 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MTTRAILNDAWELVMLFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRV IDIFDTDGNGEVDFKVAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTII NADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgactacgagggccattcttaatgatgcttgggagttggtcatgctgtttgatgctgat gaaattaaaaggctaggaaaaagatttaagaaacttgatttggacaactctggttctttg agcgtggaagagttcatgtctttgcccgagttacaacagaatcctttagtacagcgagta atagatatattcgacacagatgggaatggagaggtagactttaaagttgctttccgaatc tatgacatggataaagatggctatatttccaatggggaactcttccaggtgctgaagatg atggtggggaacaatctgaaagatacacaattacagcaaatcgtagacaaaaccataata aatgcagataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggt ggcctagatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system