Sorex araneus (European shrew): 101556810 Help Entry 101556810         CDS       T07854                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism sara  Sorex araneus (European shrew) Pathway sara04024   cAMP signaling pathway sara04062   Chemokine signaling pathway sara04064   NF-kappa B signaling pathway sara04210   Apoptosis sara04380   Osteoclast differentiation sara04620   Toll-like receptor signaling pathway sara04621   NOD-like receptor signaling pathway sara04622   RIG-I-like receptor signaling pathway sara04623   Cytosolic DNA-sensing pathway sara04625   C-type lectin receptor signaling pathway sara04657   IL-17 signaling pathway sara04658   Th1 and Th2 cell differentiation sara04659   Th17 cell differentiation sara04660   T cell receptor signaling pathway sara04662   B cell receptor signaling pathway sara04668   TNF signaling pathway sara04722   Neurotrophin signaling pathway sara04920   Adipocytokine signaling pathway sara04926   Relaxin signaling pathway sara04931   Insulin resistance sara04936   Alcoholic liver disease sara05132   Salmonella infection sara05134   Legionellosis sara05135   Yersinia infection sara05140   Leishmaniasis sara05142   Chagas disease sara05145   Toxoplasmosis sara05160   Hepatitis C sara05161   Hepatitis B sara05162   Measles sara05163   Human cytomegalovirus infection sara05164   Influenza A sara05166   Human T-cell leukemia virus 1 infection sara05167   Kaposi sarcoma-associated herpesvirus infection sara05168   Herpes simplex virus 1 infection sara05169   Epstein-Barr virus infection sara05170   Human immunodeficiency virus 1 infection sara05171   Coronavirus disease - COVID-19 sara05200   Pathways in cancer sara05203   Viral carcinogenesis sara05208   Chemical carcinogenesis - reactive oxygen species sara05215   Prostate cancer sara05220   Chronic myeloid leukemia sara05222   Small cell lung cancer sara05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sara05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101556810 (NFKBIA)    04668 TNF signaling pathway     101556810 (NFKBIA)    04024 cAMP signaling pathway     101556810 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101556810 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101556810 (NFKBIA)    04621 NOD-like receptor signaling pathway     101556810 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     101556810 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     101556810 (NFKBIA)    04625 C-type lectin receptor signaling pathway     101556810 (NFKBIA)    04660 T cell receptor signaling pathway     101556810 (NFKBIA)    04658 Th1 and Th2 cell differentiation     101556810 (NFKBIA)    04659 Th17 cell differentiation     101556810 (NFKBIA)    04657 IL-17 signaling pathway     101556810 (NFKBIA)    04662 B cell receptor signaling pathway     101556810 (NFKBIA)    04062 Chemokine signaling pathway     101556810 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101556810 (NFKBIA)    04926 Relaxin signaling pathway     101556810 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101556810 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     101556810 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101556810 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     101556810 (NFKBIA)    05203 Viral carcinogenesis     101556810 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101556810 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     101556810 (NFKBIA)    05215 Prostate cancer     101556810 (NFKBIA)    05222 Small cell lung cancer     101556810 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101556810 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     101556810 (NFKBIA)    05161 Hepatitis B     101556810 (NFKBIA)    05160 Hepatitis C     101556810 (NFKBIA)    05171 Coronavirus disease - COVID-19     101556810 (NFKBIA)    05164 Influenza A     101556810 (NFKBIA)    05162 Measles     101556810 (NFKBIA)    05168 Herpes simplex virus 1 infection     101556810 (NFKBIA)    05163 Human cytomegalovirus infection     101556810 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     101556810 (NFKBIA)    05169 Epstein-Barr virus infection     101556810 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101556810 (NFKBIA)    05135 Yersinia infection     101556810 (NFKBIA)    05134 Legionellosis     101556810 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101556810 (NFKBIA)    05140 Leishmaniasis     101556810 (NFKBIA)    05142 Chagas disease     101556810 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101556810 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101556810 (NFKBIA)    04931 Insulin resistance     101556810 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sara03000]     101556810 (NFKBIA)    04131 Membrane trafficking [BR:sara04131]     101556810 (NFKBIA) Transcription factors [BR:sara03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     101556810 (NFKBIA) Membrane trafficking [BR:sara04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101556810 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  101556810 NCBI-ProteinID:  XP_004612177 LinkDB All DBs Position Unknown AA seq 318 aa AA seqDB search MFQHVEPAPERAPDGPRDPLKKERLLEDRHDSGLDSMKDEEYEQMVKELQEIRLETQAAP SGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVHRVKGDLAFVNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCGTQRLYSILRATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAKEPCNGRTALHLAVDLQNSDLVALLLKCG ADVNSVTYQGYSPYQLTWGRPSTQIQQQLGQFTQENLQMLPESEDEENSDSEAEFTSEEE EDELLYDDCVLGGQRLTL NT seq 957 nt NT seq  +upstreamnt  +downstreamnt atgtttcagcacgtcgagccagccccggagcgggccccggacggcccccgggaccctctg aagaaggagcggctgctcgaggaccgccacgacagcggcctggactccatgaaagatgag gagtatgagcagatggtgaaggagctgcaggagatccgcctggagacgcaggcggcaccc agcggcgccgagccatggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccacgaagagaaggcgctgaccatggaagtggtccacagggtgaagggagac ctggccttcgtcaacttccagaacaacctgcagcagactcctctccacttggctgtgatc accaaccagccagaaattgctgaggcgcttctggaagctggctgtgatccggagctccga gactttcgaggaaatacccccctacacctggcctgtgagcagggctgcctggccagcgtg ggcgtcctgactcagacctgtgggacccagcgcctctattccatcctgcgggccaccaac tacaacggtcacacgtgtttgcacttagcctccatccacggctacctgggcattgtggag ctcttggtgtccttgggtgctgatgtcaatgcaaaggagccctgcaatggccggactgcc ctgcacctggcggtggacctgcagaattctgacctggtggccctcctgttgaagtgtggg gctgatgttaacagtgtcacctatcaaggctactccccataccagctcacctggggccgc cccagcacgcagatccagcaacagctgggccagttcacgcaagagaacctgcagatgctg ccagagagcgaggacgaggagaactctgactcggaggccgagttcacttcggaggaagag gaggacgagctgctctatgatgactgtgtccttggaggccagcgcctgacgttataa

DBGET integrated database retrieval system